Banner

Recombinant Human BMP7 Protein (Active)

Recombinant Human BMP7 Protein (Active) (RMPP-00230793)

Cat. No.: RMPP-00230793

Category: Growth Factors & Cytokines

Research Area: Immunology

INQUIRY 10 μg Customer Size

Product Features

Source HEK 293 cells
Purity ≥ 95% SDS-PAGE. Purity by HPLC ≥95%.
Nature Recombinant
Endotoxin Level ≤ 0.050 Eu/µg
Carrier Free Yes
Animal Free Yes
Form Lyophilized
Applications SDS-PAGE; HPLC; Cell Culture
Key Features Expression system: HEK 293 cells; Purity: ≥ 95% SDS-PAGE; Endotoxin level: ≤ 0.050 Eu/µg; Active: Yes; Suitable for: SDS-PAGE, Functional Studies, MS, HPLC, Cell Culture

Protein Information

UniProt ID P13232
Molecular Weight 17 kDa
Molecular Weight Information M +1.38 Da ( +365 Da: Hex(1)HexNAc(1); +203 Da: HexNAc: +283 Da: s/pGlcNac) (Calc. mass 17444.62 Da).

DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH
Sequence Similarities Belongs to the IL-7/IL-9 family.
Protein Length Full length protein
Cellular Localization Secreted.
Function Hematopoietic growth factor capable of stimulating the proliferation of lymphoid progenitors. It is important for proliferation during certain stages of B-cell maturation.

Storage & Shipping

Shipping and Storage Shipped at Room Temperature. Store at Room Temperature.
pH: 6.00Constituents: 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Monobasic dihydrogen potassium phosphate, 10.26% TrehaloseBuffer lyophilized from.
This product is an active protein and may elicit a biological response in vivo, handle with caution.

For research use only. Not for clinical use.