Recombinant Human BMP7 Protein (RMPP-00231034)
Cat. No.: RMPP-00231034
Category: Recombinant Protein
Research Area: Immunology
INQUIRY
100 μg
Customer Size
Product Features
| Source | Wheat germ |
|---|---|
| Nature | Recombinant |
| Animal Free | No |
| Form | Liquid |
| Applications | WB; SDS-PAGE; ELISA |
| Key Features | Expression system: Wheat germ; Suitable for: WB, SDS-PAGE, ELISA |
Protein Information
| UniProt ID | P30203 |
|---|---|
| Molecular Weight | 36 kDa including tags |
| Sequence | CGTAVERPKGLPHSLSGRMYYSCNGEELTLSNCSWRFNNSNLCSQSLAAR VLCSASRSLHNLSTPEVPASVQTVTIESSVTVKIENKESRELM |
| Sequence Similarities | Contains 3 SRCR domains. |
| Protein Length | Protein fragment |
| Cellular Localization | Membrane. |
| Tissue Specificity | Expressed by thymocytes, mature T-cells, a subset of B-cells known as B-1 cells, and by some cells in the brain. |
| Function | Involved in cell adhesion. Binds to CD166. |
| Post-translational Modifications | After T-cell activation, becomes hyperphosphorylated on Ser and Thr residues and phosphorylated on Tyr residues.Contains intrachain disulfide bond(s). |
Storage & Shipping
| Shipping and Storage | Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles. pH: 8.00Constituents: 0.3% Glutathione, 0.79% Tris HCl |
|---|
For research use only. Not for clinical use.
