Recombinant Human BMPR2 Protein (Fc Chimera His Tag) (RMPP-00230481)
Cat. No.: RMPP-00230481
Category: Growth Factors & Cytokines
Research Area: Immunology
INQUIRY
100 μg
Customer Size
Product Features
| Source | E.coli |
|---|---|
| Purity | > 98% SDS-PAGE. |
| Nature | Recombinant |
| Endotoxin Level | < 1.000 Eu/µg |
| Animal Free | No |
| Form | Lyophilized |
| Applications | HPLC; Functional Studies; SDS-PAGE |
| Key Features | Expression system: E.coli; Purity: > 98% SDS-PAGE; Endotoxin level: < 1.000 Eu/µg; Active: Yes; Suitable for: HPLC, Functional Studies, SDS-PAGE |
Protein Information
| UniProt ID | P08700 |
|---|---|
| Molecular Weight | 15 kDa |
| Sequence | MDTHRLTRTLNCSSIVKEIIGKLPEPELKTDDEGPSLRNKSFRRVNLSKF VESQGEVDPEDRYVIKSNLQLNCCLPTSANDSALPGVFIRDLDDFRKKLR FYMVHLNDLETVLTSRPPQPASGSVSPNRGTVEC |
| Sequence Similarities | Belongs to the IL-3 family. |
| Protein Length | Protein fragment |
| Cellular Localization | Secreted. |
| Tissue Specificity | Activated T-cells, mast cells, natural killer cells. |
| Function | Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages.This CSF induces granulocytes, macrophages, mast cells, stem cells, erythroid cells, eosinophils and megakaryocytes. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle. Please see notes section. Store under desiccating conditions. pH: 7.40Constituent: 100% PBSLyophilized from a 0.2 mm filtered solution. This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.
