Recombinant Human BRG1 Protein (RMPP-00230397)
Cat. No.: RMPP-00230397
Category: Recombinant Protein
Research Area: Epigenetics and Nuclear Signaling
INQUIRY
5 μg
Customer Size
Product Features
| Source | E.coli |
|---|---|
| Purity | > 75% SDS-PAGE. |
| Nature | Recombinant |
| Animal Free | No |
| Form | Liquid |
| Applications | Functional Studies; SDS-PAGE |
| Key Features | Expression system: E.coli; Purity: > 75% SDS-PAGE; Active: Yes; Suitable for: Functional Studies, SDS-PAGE |
Protein Information
| UniProt ID | O43474 |
|---|---|
| Molecular Weight | 53 kDa including tags |
| Sequence | MRQPPGESDMAVSDALLPSFSTFASGPAGREKTLRQAGAPNNRWREELSH MKRLPPVLPGRPYDLAAATVATDLESGGAGAACGGSNLAPLPRRETEEFN DLLDLDFILSNSLTHPPESVAATVSSSASASSSSSPSSSGPASAPSTCSF TYPIRAGNDPGVAPGGTGGGLLYGRESAPPPTAPFNLADINDVSPSGGFV AELLRPELDPVYIPPQQPQPPGGGLMGKFVLKASLSAPGSEYGSPSVISV SKGSPDGSHPVVVAPYNGGPPRTCPKIKQEAVSSCTHLGAGPPLSNGHRP AAHDFPLGRQLPSRTTPTLGLEEVLSSRDCHPALPLPPGFHPHPGPNYPS FLPDQMQPQVPPLHYQELMPPGSCMPEEPKPKRGRRSWPRKRTATHTCDY AGCGKTYTKSSHLKAHLRTHTGEKPYHCDWDGCGWKFARSDELTRHYRKH TGHRPFQCQKCDRAFSRSDHLALHMKRHFESGGGGSPGRRRRRRRRRRR |
| Sequence Similarities | Belongs to the krueppel C2H2-type zinc-finger protein family. Contains 3 C2H2-type zinc fingers. |
| Protein Length | Full length protein |
| Cellular Localization | Nucleus. |
| Domain | the 9aaTAD motif is a transactivation domain present in a large number of yeast and animal transcription factors. |
| Function | Transcription factor; can act both as activator and as repressor. Binds the 5'-CACCC-3' core sequence. Binds to the promoter region of its own gene and can activate its own transcription. Regulates the expression of key transcription factors during embryonic development. Plays an important role in maintaining embryonic stem cells, and in preventing their differentiation. Required for establishing the barrier function of the skin and for postnatal maturation and maintenance of the ocular surface. Involved in the differentiation of epithelial cells and may also function in skeletal and kidney development. Contributes to the down-regulation of p53/TP53 transcription. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. pH: 7.50Constituents: Potassium chloride, 0.24% Tris, EDTA, Glycerol, Sodium chlorideAlso contains DTT and Arginine. This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.
