Banner

Recombinant Human c-Kit (mutated D816Y) Protein (Active)

Recombinant Human c-Kit (mutated D816Y) Protein (Active) (RMPP-00230479)

Cat. No.: RMPP-00230479

Category: Recombinant Protein

Research Area: Stem Cells

INQUIRY 5 μg Customer Size

Product Features

Source CHO cells
Purity ≥ 95% SDS-PAGE. ≥ 95% by HPLC analysis.
Nature Recombinant
Animal Free No
Form Lyophilized
Applications HPLC; Functional Studies; SDS-PAGE
Key Features Expression system: CHO cells; Purity: ≥ 95% SDS-PAGE; Active: Yes; Suitable for: HPLC, Functional Studies, SDS-PAGE

Protein Information

UniProt ID Q9BQB4
Molecular Weight 22 kDa
Sequence QGWQAFKNDATEIIPELGEYPEPPPELENNKTMNRAENGGRPPHHPFETK DVSEYSCRELHFTRYVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRGK WWRPSGPDFRCIPDRYRAQRVQLLCPGGEAPRARKVRLVASCKCKRLTRF HNQSELKDFGTEAARPQKGRKPRPRARSAKANQAELENAY
Sequence Similarities Belongs to the sclerostin family. Contains 1 CTCK (C-terminal cystine knot-like) domain.
Protein Length Full length protein
Cellular Localization Secreted.
Tissue Specificity Widely expressed at low levels with highest levels in bone, cartilage, kidney, liver, bone marrow and primary osteeoblasts differentiated for 21 days.
Function Negative regulator of bone growth.
Involvement in Disease Defects in SOST are the cause of sclerosteosis (SOST); also known as cortical hyperostosis with syndactyly. SOST is an autosomal recessive sclerosing bone dysplasia characterized by a generalized hyperostosis and sclerosis leading to a markedly thickened skull, with mandible, ribs, clavicles and all long bones also being affected. Due to narrowing of the foramina of the cranial nerves, facial nerve palsy, hearing loss and atrophy of the optic nerves can occur. Sclerosteosis is clinically and radiologically very similar to van Buchem disease, mainly differentiated by hand malformations and a large stature in sclerosteosis patients.Note=A 52 kb deletion downstream of SOST results in SOST transcription suppression and is a cause of van Buchem disease (VBCH); also known as hyperostosis corticalis generalisata. VBCH is an autosomal recessive sclerosing bone dysplasia characterized by endosteal hyperostosis of the mandible, skull, ribs, clavicles, and diaphyses of the long bones. Affected patients present a symmetrically increased thickness of bones, most frequently found as an enlarged jawbone, but also an enlargement of the skull, ribs, diaphysis of long bones, as well as tubular bones of hands and feet. The clinical consequence of increased thickness of the skull include facial nerve palsy causing hearing loss, visual problems, neurological pain, and, very rarely, blindness as a consequence of optic atrophy. Serum alkaline phosphatase levels are elevated.

Storage & Shipping

Shipping and Storage Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
This product is an active protein and may elicit a biological response in vivo, handle with caution.

For research use only. Not for clinical use.