Recombinant Human CD27 Protein (His tag) (RMPP-00230785)
Cat. No.: RMPP-00230785
Category: Growth Factors & Cytokines
Research Area: Cardiovascular
INQUIRY
20 μg
Customer Size
Product Features
| Source | E.coli |
|---|---|
| Purity | > 98% SDS-PAGE. |
| Nature | Recombinant |
| Endotoxin Level | < 1.000 Eu/µg |
| Animal Free | No |
| Form | Lyophilized |
| Applications | SDS-PAGE; HPLC |
| Key Features | Expression system: E.coli; Purity: > 98% SDS-PAGE; Endotoxin level: < 1.000 Eu/µg; Active: Yes; Suitable for: SDS-PAGE, Functional Studies, HPLC |
Protein Information
| UniProt ID | P09038 |
|---|---|
| Molecular Weight | 16 kDa |
| Sequence | MPALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPH VKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLES NNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
| Sequence Similarities | Belongs to the heparin-binding growth factors family. |
| Protein Length | Protein fragment |
| Cellular Localization | Secreted. Nucleus. Exported from cells by an endoplasmic reticulum (ER)/Golgi-independent mechanism. Unconventional secretion of FGF2 occurs by direct translocation across the plasma membrane. Binding of exogenous FGF2 to FGFR facilitates endocytosis followed by translocation of FGF2 across endosomal membrane into the cytosol. Nuclear import from the cytosol requires the classical nuclear import machinery, involving proteins KPNA1 and KPNB1, as well as CEP57. |
| Tissue Specificity | Expressed in granulosa and cumulus cells. Expressed in hepatocellular carcinoma cells, but not in non-cancerous liver tissue. |
| Function | Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro. Can induce angiogenesis. |
| Post-translational Modifications | Phosphorylation at Tyr-215 regulates FGF2 unconventional secretion.Several N-termini starting at positions 94, 125, 126, 132, 143 and 162 have been identified by direct sequencing. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Store at -20°C. pH: 7.40Constituent: 100% PBS This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.
