Recombinant Human CD3 epsilon Protein

Products

Online Inquiry

Recombinant Human CD3 epsilon Protein (RMPP-00230218)

Cat. No.: RMPP-00230218

Category: Recombinant Protein

Research Area: Immunology

INQUIRY 10 μg Customer Size

Product Features

Source	HEK 293 cells
Purity	> 98% SDS-PAGE.
Nature	Recombinant
Endotoxin Level	< 1.000 Eu/µg
Animal Free	No
Tags	Fc tag C-Terminus
Form	Lyophilized
Applications	Functional Studies; SDS-PAGE
Key Features	Expression system: HEK 293 cells; Purity: > 98% SDS-PAGE; Endotoxin level: < 1.000 Eu/µg; Active: Yes; Tags: Fc tag C-Terminus; Suitable for: Functional Studies, SDS-PAGE

Protein Information

UniProt ID	P05362
Molecular Weight	76 kDa including tags
Sequence	AQTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGIETPLPKKELLLPGNNR KVYELSNVQEDSQPMCYSNCPDGQSTAKTFLTVYWTPERVELAPLPSWQP VGKNLTLRCQVEGGAPRANLTVVLLRGEKELKREPAVGEPAEVTTTVLVR RDHHGANFSCRTELDLRPQGLELFENTSAPYQLQTFVLPATPPQLVSPRV LEVDTQGTVVCSLDGLFPVSEAQVHLALGDQRLNPTVTYGNDSFSAKASV SVTAEDEGTQRLTCAVILGNQSQETLQTVTIYSFPAPNVILTKPEVSEGT EVTVKCEAHPRAKVTLNGVPAQPLGPRAQLLLKATPEDNGRSFSCSATLE VAGQLIHKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTPMCQAWGNPL PELKCLKDGTFPLPIGESVTVTRDLEGTYLCRARSTQGEVTRKVTVNVLS PRYE
Sequence Similarities	Belongs to the immunoglobulin superfamily. ICAM family. Contains 5 Ig-like C2-type (immunoglobulin-like) domains.
Protein Length	Protein fragment
Cellular Localization	Membrane.
Function	ICAM proteins are ligands for the leukocyte adhesion protein LFA-1 (integrin alpha-L/beta-2). During leukocyte trans-endothelial migration, ICAM1 engagement promotes the assembly of endothelial apical cups through ARHGEF26/SGEF and RHOG activation. In case of rhinovirus infection acts as a cellular receptor for the virus.
Post-translational Modifications	Monoubiquitinated, which is promoted by MARCH9 and leads to endocytosis.

Storage & Shipping

Shipping and Storage	Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -80°C. Avoid freeze / thaw cycle. pH: 7.4Constituents: 5% Trehalose, 0.75% Glycine, 0.6% TrisStorage buffer: Lyophilized from 0.22 µm filtered solution in 50 mM tris, 100 mM glycine, pH7.5. Normally Mannitol or Trehalose are added as protectants before lyophilization. This product is an active protein and may elicit a biological response in vivo, handle with caution.

Shipping and Storage

Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -80°C. Avoid freeze / thaw cycle.
pH: 7.4Constituents: 5% Trehalose, 0.75% Glycine, 0.6% TrisStorage buffer:
Lyophilized from 0.22 µm filtered solution in 50 mM tris, 100 mM glycine, pH7.5. Normally Mannitol or Trehalose are added as protectants before lyophilization.
This product is an active protein and may elicit a biological response in vivo, handle with caution.

For research use only. Not for clinical use.