Recombinant Human CD80 Protein (Active) (RMPP-00230152)
Cat. No.: RMPP-00230152
Category: Recombinant Protein
Research Area: Signal Transduction
INQUIRY
100 μg
Customer Size
Product Features
| Source | Wheat germ |
|---|---|
| Nature | Recombinant |
| Animal Free | No |
| Form | Liquid |
| Applications | ELISA; WB; SDS-PAGE |
| Key Features | Expression system: Wheat germ; Suitable for: ELISA, WB, SDS-PAGE |
Protein Information
| UniProt ID | P56199 |
|---|---|
| Molecular Weight | 38 kDa including tags |
| Sequence | QFYSSASEYHISIAANETVPEVINSTEDIGNEINIFYLIRKSGSFPMPEL KLSISFPNMTSNGYPVLYPTGLSSSENANCRPHIFEDPFSINSGKKMTTS TDHLKRGTI |
| Sequence Similarities | Belongs to the integrin alpha chain family. Contains 7 FG-GAP repeats. Contains 1 VWFA domain. |
| Protein Length | Protein fragment |
| Cellular Localization | Membrane. |
| Domain | The integrin I-domain (insert) is a VWFA domain. Integrins with I-domains do not undergo protease cleavage. |
| Function | Integrin alpha-1/beta-1 is a receptor for laminin and collagen. It recognizes the proline-hydroxylated sequence G-F-P-G-E-R in collagen. |
Storage & Shipping
| Shipping and Storage | Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles. pH: 8.00Constituents: 0.31% Glutathione, 0.79% Tris HCl |
|---|
For research use only. Not for clinical use.
