Recombinant Human CD80 Protein (Active) (RMPP-00230769)
Cat. No.: RMPP-00230769
Category: Recombinant Protein
Research Area: Neuroscience
INQUIRY
100 μg
50 μg
Product Features
| Source | E.coli |
|---|---|
| Purity | > 95% SDS-PAGE. |
| Nature | Recombinant |
| Endotoxin Level | ≤ 1.000 Eu/µg |
| Animal Free | Yes |
| Form | Lyophilized |
| Applications | SDS-PAGE; HPLC |
| Key Features | Expression system: E.coli; Purity: > 95% SDS-PAGE; Endotoxin level: ≤ 1.000 Eu/µg; Active: Yes; Suitable for: SDS-PAGE, Functional Studies, HPLC |
Protein Information
| UniProt ID | P23560 |
|---|---|
| Molecular Weight | 27 kDa |
| Sequence | MHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQL KQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIG WRFIRIDTSCVCTLTIKRGR |
| Sequence Similarities | Belongs to the NGF-beta family. |
| Protein Length | Full length protein |
| Cellular Localization | Secreted. |
| Tissue Specificity | Brain. Highly expressed in hippocampus, amygdala, cerebral cortex and cerebellum. Also expressed in heart, lung, skeletal muscle, testis, prostate and placenta. |
| Function | During development, promotes the survival and differentiation of selected neuronal populations of the peripheral and central nervous systems. Participates in axonal growth, pathfinding and in the modulation of dendritic growth and morphology. Major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS. The versatility of BDNF is emphasized by its contribution to a range of adaptive neuronal responses including long-term potentiation (LTP), long-term depression (LTD), certain forms of short-term synaptic plasticity, as well as homeostatic regulation of intrinsic neuronal excitability. |
| Involvement in Disease | Bulimia nervosa 2Congenital central hypoventilation syndrome |
| Post-translational Modifications | The propeptide is N-glycosylated and glycosulfated.Converted into mature BDNF by plasmin (PLG). |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Store at -20°C long term. Avoid freeze / thaw cycle. Constituent: 0.1% Trifluoroacetic acidLyophilized from a sterile 0.2 micron filtered solution. This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.
