Recombinant Human CD86 Protein (Fc Chimera) (RMPP-00230149)
Cat. No.: RMPP-00230149
Category: Recombinant Protein
Research Area: Neuroscience
INQUIRY
200 μg
Customer Size
Product Features
| Source | Wheat germ |
|---|---|
| Nature | Recombinant |
| Animal Free | No |
| Form | Liquid |
| Applications | ELISA; WB; SDS-PAGE |
| Key Features | Expression system: Wheat germ; Suitable for: ELISA, WB, SDS-PAGE |
Protein Information
| UniProt ID | P49757 |
|---|---|
| Molecular Weight | 41 kDa including tags |
| Sequence | MPYPAPNVPVVGITPSQMVANVFGTAGHPQAAHPHQSPSLVRQQTFPHYE ASSATTSPFFKPPAQHLNGSAAFNGVDDGRLASADRHTEVPTGTCPVDPF EAQWAALENKSKQRTNPSPTNPFSSDLQKTFEIEL |
| Sequence Similarities | Contains 1 PID domain. |
| Protein Length | Full length protein |
| Cellular Localization | Membrane. |
| Function | Plays a role in the process of neurogenesis. Required throughout embryonic neurogenesis to maintain neural progenitor cells, also called radial glial cells (RGCs), by allowing their daughter cells to choose progenitor over neuronal cell fate. Not required for the proliferation of neural progenitor cells before the onset of neurogenesis. Also involved postnatally in the subventricular zone (SVZ) neurogenesis by regulating SVZ neuroblasts survival and ependymal wall integrity. May also mediate local repair of brain ventricular wall damage. |
| Post-translational Modifications | Isoform 1 and isoform 2 are ubiquitinated by LNX leading to their subsequent proteasomal degradation (By similarity). Ubiquitinated; mediated by SIAH1 and leading to its subsequent proteasomal degradation. |
Storage & Shipping
| Shipping and Storage | Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles. pH: 8.00Constituents: 0.31% Glutathione, 0.79% Tris HCl |
|---|
For research use only. Not for clinical use.
