Recombinant Human CRTAC1 Protein (RMPP-00230451)
Cat. No.: RMPP-00230451
Category: Recombinant Protein
Research Area: Immunology
INQUIRY
10 μg
Customer Size
Product Features
| Source | E.coli |
|---|---|
| Purity | > 98% SDS-PAGE. Endotoxin level is less than 0. 1 ng per g (1EU/g). |
| Nature | Recombinant |
| Animal Free | No |
| Form | Lyophilized |
| Applications | Functional Studies; SDS-PAGE; WB |
| Key Features | Expression system: E.coli; Purity: > 98% SDS-PAGE; Active: Yes; Suitable for: Functional Studies, SDS-PAGE, WB |
Protein Information
| UniProt ID | P09341 |
|---|---|
| Molecular Weight | 11 kDa |
| Sequence | APVANELRCQCLQTVAGIHFKNIQSLKVMP PGPHCTQTEVIATLKNGREACLDPEAPMVQ KIVQKMLKGVPK |
| Sequence Similarities | Belongs to the intercrine alpha (chemokine CxC) family. |
| Protein Length | Full length protein |
| Cellular Localization | Secreted. |
| Function | Has chemotactic activity for neutrophils. May play a role in inflammation and exerts its effects on endothelial cells in an autocrine fashion. In vitro, the processed forms GRO-alpha(4-73), GRO-alpha(5-73) and GRO-alpha(6-73) show a 30-fold higher chemotactic activity. |
| Post-translational Modifications | N-terminal processed forms GRO-alpha(4-73), GRO-alpha(5-73) and GRO-alpha(6-73) are produced by proteolytic cleavage after secretion from peripheral blood monocytes. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.
