Recombinant Human CTLA4 Protein (Fc Chimera Active) (RMPP-00230763)
Cat. No.: RMPP-00230763
Category: Growth Factors & Cytokines
Research Area: Signal Transduction
INQUIRY
100 μg
Customer Size
Product Features
| Source | HEK 293 cells |
|---|---|
| Purity | > 98% SDS-PAGE. Lyophilized from 0. 22µm filtered solution |
| Nature | Recombinant |
| Endotoxin Level | < 1.000 Eu/µg |
| Animal Free | No |
| Tags | Fc tag N-Terminus |
| Form | Lyophilized |
| Applications | SDS-PAGE; Functional Studies; ELISA |
| Key Features | Expression system: HEK 293 cells; Purity: > 98% SDS-PAGE; Endotoxin level: < 1.000 Eu/µg; Active: Yes; Tags: Fc tag N-Terminus; Suitable for: SDS-PAGE, Functional Studies, ELISA |
Protein Information
| UniProt ID | P05019 |
|---|---|
| Molecular Weight | 35 kDa including tags |
| Sequence | GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFR SCDLRRLEMYCAPLKPAKSA |
| Sequence Similarities | Belongs to the insulin family. |
| Protein Length | Full length protein |
| Cellular Localization | Secreted. |
| Function | The insulin-like growth factors, isolated from plasma, are structurally and functionally related to insulin but have a much higher growth-promoting activity. May be a physiological regulator of -2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblasts. Stimulates glucose transport in rat bone-derived osteoblastic (PyMS) cells and is effective at much lower concentrations than insulin, not only regarding glycogen and DNA synthesis but also with regard to enhancing glucose uptake. |
| Involvement in Disease | Defects in IGF1 are the cause of insulin-like growth factor I deficiency (IGF1 deficiency). IGF1 deficiency is an autosomal recessive disorder characterized by growth retardation, sensorineural deafness and mental retardation. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. pH: 7.4Constituents: 0.75% Glycine, 0.605% Tris5-10% trehalose is commonly used for freeze drying, and after reconstitution, the trehalose is mostly about 3-5% This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.
