Banner

Recombinant Human CXCL2 Protein (Active)

Recombinant Human CXCL2 Protein (Active) (RMPP-00230762)

Cat. No.: RMPP-00230762

Category: Recombinant Protein

Research Area: Immunology

INQUIRY 10 μg 1 mg

Product Features

Source HEK 293 cells
Purity > 95% SDS-PAGE.
Nature Recombinant
Endotoxin Level < 1.000 Eu/µg
Animal Free No
Tags His tag C-Terminus
Form Lyophilized
Applications SDS-PAGE; Functional Studies; ELISA
Key Features Expression system: HEK 293 cells; Purity: > 95% SDS-PAGE; Endotoxin level: < 1.000 Eu/µg; Active: Yes; Tags: His tag C-Terminus; Suitable for: SDS-PAGE, Functional Studies, ELISA

Protein Information

UniProt ID P42081
Molecular Weight 27 kDa including tags
Sequence APLKIQAYFNETADLPCQFANSQNRSLSELVVFWQNQENLVLNEVYLGKE KFDSVHSKYMGRTSFDPESWTLRLHNLQIKDKGLYQCIIHHKRPTGMIRI HQMNSELSVLANFSQPEIVPISNITENMYINLTCSSIHGYPEPEKMSVLL RTKNSTIEYDGVMQKSQDNVTELYDVSIS LSVSFPDVTSNMTIFCVLETDKTQLLSSPFSIELEDPQPPPDH
Sequence Similarities Contains 1 Ig-like C2-type (immunoglobulin-like) domain. Contains 1 Ig-like V-type (immunoglobulin-like) domain.
Protein Length Protein fragment
Cellular Localization Membrane.
Tissue Specificity Expressed by activated B-lymphocytes and monocytes.
Function Receptor involved in the costimulatory signal essential for T-lymphocyte proliferation and interleukin-2 production, by binding CD28 or CTLA-4. May play a critical role in the early events of T-cell activation and costimulation of naive T-cells, such as deciding between immunity and anergy that is made by T-cells within 24 hours after activation. Isoform 2 interferes with the formation of CD86 clusters, and thus acts as a negative regulator of T-cell activation.
Post-translational Modifications Polyubiquitinated; which is promoted by MARCH8 and results in endocytosis and lysosomal degradation.

Storage & Shipping

Shipping and Storage Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 7.40Constituents: 97% PBS, 3% Trehalose5-10% trehalose is commonly used for freeze drying, and after reconstitution, the trehalose is about 3-5%. Lyophilized from 0.22 µm filtered solution
This product is an active protein and may elicit a biological response in vivo, handle with caution.

For research use only. Not for clinical use.