Recombinant Human DDX4 / MVH Protein (RMPP-00230442)
Cat. No.: RMPP-00230442
Category: Growth Factors & Cytokines
Research Area: Immunology
INQUIRY
10 μg
Customer Size
Product Features
| Source | E.coli |
|---|---|
| Purity | > 95% SDS-PAGE. |
| Nature | Recombinant |
| Endotoxin Level | < 1.000 Eu/µg |
| Animal Free | No |
| Tags | His tag N-Terminus |
| Modifications | mutated C146 |
| Form | Liquid |
| Applications | Functional Studies; MS |
| Key Features | Expression system: E.coli; Purity: > 95% SDS-PAGE; Endotoxin level: < 1.000 Eu/µg; Active: Yes; Tags: His tag N-Terminus; Suitable for: Functional Studies, SDS-PAGE, MS |
Protein Information
| UniProt ID | P60568 |
|---|---|
| Molecular Weight | 18 kDa including tags |
| Sequence | MGSSHHHHHHSSGLVPRGSHMGSAPASSSTKETQQQLEQLLLDLRLLLNG VNNPENPKLSRMLTFKFYVPKKATELTHLQCLVEELKPLEEVLYLAQSKN FHLNHIKELMSNINVTVLKLKGSETRFTCNYDDETATIVEFLNKWITFSQ SIFSTLT |
| Sequence Similarities | Belongs to the IL-2 family. |
| Protein Length | Full length protein |
| Cellular Localization | Secreted. |
| Function | Produced by T-cells in response to antigenic or mitogenic stimulation, this protein is required for T-cell proliferation and other activities crucial to regulation of the immune response. Can stimulate B-cells, monocytes, lymphokine-activated killer cells, natural killer cells, and glioma cells. |
| Involvement in Disease | Note=A chromosomal aberration involving IL2 is found in a form of T-cell acute lymphoblastic leukemia (T-ALL). Translocation t(4;16)(q26;p13) with involves TNFRSF17. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. pH: 8.00Constituents: 30% Glycerol (glycerin, glycerine), 0.87% Sodium chloride, 0.32% Tris HCl This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.
