Banner

Recombinant Human DPP4 Protein (RMPP-00230754)

Cat. No.: RMPP-00230754

Category: Recombinant Protein

Research Area: Epigenetics and Nuclear Signaling

INQUIRY 50 μg Customer Size

Product Features

Source E.coli
Purity > 90% SDS-PAGE.
Nature Recombinant
Animal Free No
Form Liquid
Applications SDS-PAGE; Functional Studies
Key Features Expression system: E.coli; Purity: > 90% SDS-PAGE; Active: Yes; Suitable for: SDS-PAGE, Functional Studies

Protein Information

UniProt ID Q01860
Molecular Weight 41 kDa
Sequence MAGHLASDFAFSPPPGGGGDGPGGPEPGWVDPRTWLSFQGPPGGPGIGPG VGPGSEVWGIPPCPPPYEFCGGMAYCGPQVGVGLVPQGGLETSQPEGEAG VGVESNSDGASPEPCTVTPGAVKLEKEKLEQNPEESQDIKALQKELEQFA KLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTICRFEALQLSFKNMCKL RPLLQKWVEEADNNENLQEICKAETLVQARKRKRTSIENRVRGNLENLFL QCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQKGKRSSSDYAQREDFEA AGSPFSGGPVSFPLAPGPHFGTPGYGSPHFTALYSSVPFPEGEAFPPVSV TTLGSPMHSNESGGGGSPGRRRRRRRRRRR
Sequence Similarities Belongs to the POU transcription factor family. Class-5 subfamily. Contains 1 homeobox DNA-binding domain. Contains 1 POU-specific domain.
Protein Length Full length protein
Cellular Localization Nucleus. Expressed in a diffuse and slightly punctuate pattern.
Tissue Specificity Expressed in developing brain. Highest levels found in specific cell layers of the cortex, the olfactory bulb, the hippocampus and the cerebellum. Low levels of expression in adult tissues.
Developmental Stage Highly expressed in undifferentiated embryonic stem cells and expression decreases gradually after embryoid body (EB) formation.
Domain The POU-specific domain mediates interaction with PKM2.
Function Transcription factor that binds to the octamer motif (5'-ATTTGCAT-3'). Forms a trimeric complex with SOX2 on DNA and controls the expression of a number of genes involved in embryonic development such as YES1, FGF4, UTF1 and ZFP206. Critical for early embryogenesis and for embryonic stem cell pluripotency.
Post-translational Modifications Sumoylation enhances the protein stability, DNA binding and transactivation activity. Sumoylation is required for enhanced YES1 expression.Ubiquitinated; undergoes 'Lys-63'-linked polyubiquitination by WWP2 leading to proteasomal degradation.

Storage & Shipping

Shipping and Storage Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
pH: 7.50Constituents: Calcium chloride, Potassium chloride, Magnesium chloride, 0.24% Tris, Glycerol, Sodium chlorideAlso contains DTT and Arginine.
This product is an active protein and may elicit a biological response in vivo, handle with caution.

For research use only. Not for clinical use.