Recombinant Human EHMT2/G9A Protein (RMPP-00230441)
Cat. No.: RMPP-00230441
Category: Growth Factors & Cytokines
Research Area: Cardiovascular
INQUIRY
20 μg
Customer Size
Product Features
| Source | HEK 293 cells |
|---|---|
| Purity | ≥ 95% SDS-PAGE. ≥95% purity by HPLC. |
| Nature | Recombinant |
| Endotoxin Level | ≤ 0.005 Eu/µg |
| Carrier Free | Yes |
| Animal Free | Yes |
| Form | Lyophilized |
| Applications | Functional Studies; MS; Cell Culture |
| Key Features | Expression system: HEK 293 cells; Purity: ≥ 95% SDS-PAGE; Endotoxin level: ≤ 0.005 Eu/µg; Active: Yes; Suitable for: Functional Studies, SDS-PAGE, HPLC, MS, Cell Culture |
Protein Information
| UniProt ID | P49771 |
|---|---|
| Molecular Weight | 18 kDa |
| Molecular Weight Information | Predicted MW is 18010.63 Da (+/- 10 Da by ESI-TOF). Observed MW is 18011.42, with significant heterogeneity in the protein due to multiple glycoforms. |
| Sequence | TQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGALWRL VLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTN ISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEA TAPTAPQP |
| Protein Length | Full length protein |
| Cellular Localization | Secreted and Cell membrane. |
| Function | Stimulates the proliferation of early hematopoietic cells by activating FLT3. Synergizes well with a number of other colony stimulating factors and interleukins. |
Storage & Shipping
| Shipping and Storage | Shipped at Room Temperature. Store at Room Temperature. pH: 7.4Constituents: 0.727% Dibasic monohydrogen potassium phosphate, 0.428% Monobasic dihydrogen potassium phosphate, 10.26% Trehalose This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.
