Recombinant Human ERK2 Protein (RMPP-00230634)
Cat. No.: RMPP-00230634
Category: Recombinant Protein
Research Area: Epigenetics and Nuclear Signaling
INQUIRY
50 μg
20 μg
Product Features
| Source | Wheat germ |
|---|---|
| Nature | Recombinant |
| Animal Free | No |
| Tags | GST tag N-Terminus |
| Form | Liquid |
| Applications | SDS-PAGE; WB |
| Key Features | Expression system: Wheat germ; Tags: GST tag N-Terminus; Suitable for: SDS-PAGE, ELISA, WB |
Protein Information
| UniProt ID | O00470 |
|---|---|
| Molecular Weight | 36 kDa including tags |
| Sequence | MAQRYDDLPHYGGMDGVGIPSTMYGDPHAARSMQPVHHLNHGPPLHSHQY PHTAHTNAMAPSMGSSVNDALKRDKDAIYGHPLFPLLALI |
| Sequence Similarities | Belongs to the TALE/MEIS homeobox family. Contains 1 homeobox DNA-binding domain. |
| Protein Length | Protein fragment |
| Cellular Localization | Nucleus. |
| Tissue Specificity | Expressed at low level in normal immunohepatopoietic tissues, including the fetal liver. Expressed in a subset of myeloid leukemia cell lines, with the highest expression seen in those with a megakaryocytic-erythroid phenotype. Also expressed at high levels in the cerebellum. |
| Function | Acts as a transcriptional regulator of PAX6. Acts as a transcriptional activator of PF4 in complex with PBX1 or PBX2. Required for hematopoiesis, megakaryocyte lineage development and vascular patterning. May function as a cofactor for HOXA7 and HOXA9 in the induction of myeloid leukemias. |
| Involvement in Disease | Defects in MEIS1 could be a cause of susceptibility to restless legs syndrome type 7 (RLS7). Restless legs syndrome (RLS) is a neurologic sleep/wake disorder characterized by uncomfortable and unpleasant sensations in the legs that appear at rest, usually at night, inducing an irresistible desire to move the legs. The disorder results in nocturnal insomnia and chronic sleep deprivation. |
Storage & Shipping
| Shipping and Storage | Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles. pH: 8.00Constituents: 0.31% Glutathione, 0.79% Tris HCl |
|---|
For research use only. Not for clinical use.
