Recombinant Human Fas Ligand Protein (Active) (RMPP-00231008)
Cat. No.: RMPP-00231008
Category: Recombinant Protein
Research Area: Immunology
INQUIRY
10 μg
Customer Size
Product Features
| Source | HEK 293 cells |
|---|---|
| Purity | > 90% SDS-PAGE. NULL |
| Nature | Recombinant |
| Animal Free | No |
| Tags | His tag C-Terminus, Avi tag C-Terminus |
| Form | Liquid |
| Applications | WB; SDS-PAGE |
| Key Features | Expression system: HEK 293 cells; Purity: > 90% SDS-PAGE; Tags: His tag C-Terminus, Avi tag C-Terminus; Suitable for: WB, SDS-PAGE |
Protein Information
| UniProt ID | P31994 |
|---|---|
| Molecular Weight | 23 kDa including tags |
| Sequence | APPKAVLKLEPQWINVLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHT QPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEG ETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSGDYH CTGNIGYTLYSSKPVTITVQAP |
| Sequence Similarities | Contains 2 Ig-like C2-type (immunoglobulin-like) domains. |
| Protein Length | Protein fragment |
| Cellular Localization | Cell membrane. |
| Tissue Specificity | Is the most broadly distributed Fc-gamma-receptor. Expressed in monocyte, neutrophils, macrophages, basophils, eosinophils, Langerhans cells, B-cells, platelets cells and placenta (endothelial cells). Not detected in natural killer cells. |
| Domain | Contains 1 copy of a cytoplasmic motif that is referred to as the immunoreceptor tyrosine-based inhibitor motif (ITIM). This motif is involved in modulation of cellular responses. The phosphorylated ITIM motif can bind the SH2 domain of several SH2-containing phosphatases. |
| Function | Receptor for the Fc region of complexed or aggregated immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of immune complexes and modulation of antibody production by B-cells. Binding to this receptor results in down-modulation of previous state of cell activation triggered via antigen receptors on B-cells (BCR), T-cells (TCR) or via another Fc receptor. Isoform IIB1 fails to mediate endocytosis or phagocytosis. Isoform IIB2 does not trigger phagocytosis. |
| Involvement in Disease | Note=A chromosomal aberration involving FCGR2B is found in a follicular lymphoma. Translocation t(1;22)(q22;q11). The translocation leads to the hyperexpression of the receptor. This may play a role in the tumor progression. |
Storage & Shipping
| Shipping and Storage | Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle. pH: 7.40Constituents: 0.64% Sodium chloride, 0.02% Potassium chloride, 20% Glycerol (glycerin, glycerine), 0.13% Sodium phosphate |
|---|
For research use only. Not for clinical use.
