Recombinant Human FGFR3 (mutated K650M) Protein (Active) (RMPP-00230621)
Cat. No.: RMPP-00230621
Category: Recombinant Protein
Research Area: Immunology
INQUIRY
5 μg
Customer Size
Product Features
| Source | HEK 293 cells |
|---|---|
| Purity | > 95% SDS-PAGE. |
| Nature | Recombinant |
| Endotoxin Level | < 1.000 Eu/µg |
| Animal Free | No |
| Tags | Fc tag C-Terminus |
| Form | Lyophilized |
| Applications | SDS-PAGE; ELISA |
| Key Features | Expression system: HEK 293 cells; Purity: > 95% SDS-PAGE; Endotoxin level: < 1.000 Eu/µg; Active: Yes; Tags: Fc tag C-Terminus; Suitable for: SDS-PAGE, ELISA |
Protein Information
| UniProt ID | O14931 |
|---|---|
| Molecular Weight | 40 kDa including tags |
| Sequence | LWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRN GTPEFRGRLA PLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLG VGTGNGTRLVVEKEHPQLG |
| Sequence Similarities | Belongs to the natural cytotoxicity receptor (NCR) family. Contains 1 Ig-like (immunoglobulin-like) domain. |
| Protein Length | Protein fragment |
| Cellular Localization | Cell membrane. |
| Tissue Specificity | Selectively expressed by all resting and activated NK cells and weakly expressed in spleen. |
| Function | Cytotoxicity-activating receptor that contributes to the increased efficiency of activated natural killer (NK) cells to mediate tumor cell lysis. Engagement of NCR3 by BAG6 also promotes dendritic cell (DC) maturation, both through killing those DCs that did not properly acquire a mature phenotype, and inducing NK cells to release TNFA and IFNG, which promotes DC maturation. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. Reconstitute for long term storage. pH: 7.4Constituents: 0.75% Glycine, 0.605% Tris, 5% Trehalose This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.
