Recombinant Human FJX1 Protein (RMPP-00230612)
Cat. No.: RMPP-00230612
Category: Recombinant Protein
Research Area: Immunology
INQUIRY
2 μg
Customer Size
Product Features
| Source | Insect cells |
|---|---|
| Purity | > 90% SDS-PAGE. Affinity purified |
| Nature | Recombinant |
| Endotoxin Level | < 1.000 Eu/µg |
| Animal Free | No |
| Tags | His tag C-Terminus |
| Form | Liquid |
| Applications | SDS-PAGE |
| Key Features | Expression system: Insect cells; Purity: > 90% SDS-PAGE; Endotoxin level: < 1.000 Eu/µg; Tags: His tag C-Terminus; Suitable for: SDS-PAGE |
Protein Information
| UniProt ID | P08571 |
|---|---|
| Molecular Weight | 38 kDa including tags |
| Sequence | SPAPPEPCELDEESCSCNFSDPKPDWSSAFNCLGAADVELYGGGRSLEYL LKRVDTEADLGQFTDIIKSLSLKRLTVRAARIPSRILFGALRVLGISGLQ ELTLENLEVTGTAPPPLLEATGPDLNILNLRNVSWATRDAWLAELQQWLK PGLKVLSIAQAHSLNFSCEQVRVFPALSTLDLSDNPELGERGLISALCPL KFPTLQVLALRNAGMETPSGVCSALAAARVQLQGLDLSHNSLRDAAGAPS CDWPSQLNSLNLSFTGLKQVPKGLPAKLSVLDLSYNRLDRNPSPDELPQV GNLSLKGNPFLDSESHSEKFNSGVVTAGAPSSQAVALSGTLALLLGDRLF VHHHHHH |
| Sequence Similarities | Contains 11 LRR (leucine-rich) repeats. |
| Protein Length | Full length protein |
| Cellular Localization | Cell membrane. |
| Tissue Specificity | Expressed strongly on the surface of monocytes and weakly on the surface of granulocytes; also expressed by most tissue macrophages. |
| Function | Cooperates with MD-2 and TLR4 to mediate the innate immune response to bacterial lipopolysaccharide (LPS). Acts via MyD88, TIRAP and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. Up-regulates cell surface molecules, including adhesion molecules. |
| Post-translational Modifications | N- and O- glycosylated. O-glycosylated with a core 1 or possibly core 8 glycan. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. pH: 7.40Constituents: 10% Glycerol, 90% PBS |
|---|
For research use only. Not for clinical use.
