Recombinant Human Frizzled 6 Protein (RMPP-00230337)
Cat. No.: RMPP-00230337
Category: Growth Factors & Cytokines
Research Area: Cardiovascular
INQUIRY
10 μg
Customer Size
Product Features
| Source | Baculovirus infected Sf9 cells |
|---|---|
| Purity | > 70% SDS-PAGE. Affinity purified. |
| Nature | Recombinant |
| Animal Free | No |
| Tags | GST tag N-Terminus |
| Form | Liquid |
| Applications | Functional Studies; SDS-PAGE |
| Key Features | Expression system: Baculovirus infected Sf9 cells; Purity: > 70% SDS-PAGE; Active: Yes; Tags: GST tag N-Terminus; Suitable for: Functional Studies, SDS-PAGE |
Protein Information
| UniProt ID | P35968 |
|---|---|
| Molecular Weight Information | SDS-PAGE molecular weight: ~110kDa |
| Sequence | VKRANGGELKTGYLSIVMDPDELPLDEHCERLPYDASKWEFPRDRLKLGK PLGRGAFGQVIEADAFGIDKTATCRTVAVKMLKEGATHSEHRALMSELKI LIHIGHHLNVVNLLGACTKPGGPLMVIVEFCKFGNLSTYLRSKRNEFVPY KTKGARFRQGKDYVGAIPVDLKRRLDSITSSQSSASSGFVEEKSLSDVEE EEAPEDLYKDFLTLEHLICYSFQVAKGMEFLASRKCIHRDLAARNILLSE KNVVKICDFGLARDIYKDPDYVRKGDARLPLKWMAPETIFDRVYTIQSDV WSFGVLLWEIFSLGASPYPGVKIDEEFCRRLKEGTRMRAPDYTTPEMYQT MLDCWHGEPSQRPTFSELVEHLGNLLQANAQQDGKDYIVLPISETLSMEE DSGLSLPTSPVSCMEEEEVCDPKFHYDNTAGISQYLQNSKRKSRPVSVKT FEDIPLEEPEVKVIPDDNQTDSGMVLASEELKTLEDRTKLSPSFGGMVPS KSRESVASEGSNQTSGYQSGYHSDDTDTTVYSSEEAELLKLIEIGVQTGS TAQILQPDSGTTLSSPPV |
| Sequence Similarities | Belongs to the protein kinase superfamily. Tyr protein kinase family. CSF-1/PDGF receptor subfamily. Contains 7 Ig-like C2-type (immunoglobulin-like) domains. Contains 1 protein kinase domain. |
| Protein Length | Protein fragment |
| Cellular Localization | Membrane. |
| Function | Receptor for VEGF or VEGFC. Has a tyrosine-protein kinase activity. The VEGF-kinase ligand/receptor signaling system plays a key role in vascular development and regulation of vascular permeability. In case of HIV-1 infection, the interaction with extracellular viral Tat protein seems to enhance angiogenesis in Kaposi's sarcoma lesions. |
| Involvement in Disease | Defects in KDR are associated with susceptibility to hemangioma capillary infantile (HCI). HCI are benign, highly proliferative lesions involvingthis product localized growth of capillary endothelium. They are the most common tumor of infancy, occurring in up to 10% of all births. Hemangiomas tend to appear shortly after birth and show rapid neonatal growth for up to 12 months characterized by endothelial hypercellularity and increased numbers of mast cells. This phase is followed by slow involution at a rate of about 10% per year and replacement by fibrofatty stroma. |
| Post-translational Modifications | Phosphorylated. Dephosphorylated by PTPRB. Dephosphorylated by PTPRJ at Tyr-951, Tyr-996, Tyr-1054, Tyr-1059, Tyr-1175 and Tyr-1214. |
Storage & Shipping
| Shipping and Storage | Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle. pH: 7.50Constituents: 0.79% Tris HCl, 0.87% Sodium chloride, 0.004% DTT, 0.004% EGTA, 0.003% EDTA, 0.002% PMSF, 25% Glycerol (glycerin, glycerine) This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.
