Banner

Recombinant Human FUT4 Protein (RMPP-00230336)

Cat. No.: RMPP-00230336

Category: Growth Factors & Cytokines

Research Area: Cardiovascular

INQUIRY 10 μg Customer Size

Product Features

Source Baculovirus infected Sf9 cells
Purity > 70% SDS-PAGE. Affinity purified.
Nature Recombinant
Animal Free No
Tags GST tag N-Terminus
Form Liquid
Applications Functional Studies; SDS-PAGE
Key Features Expression system: Baculovirus infected Sf9 cells; Purity: > 70% SDS-PAGE; Active: Yes; Tags: GST tag N-Terminus; Suitable for: Functional Studies, SDS-PAGE

Protein Information

Molecular Weight Information 150 kDa by SDS-PAGE
Sequence MMEAIKKKMQMLKLDKENALDRAEQAEAEQKQAEERSKQLEDELAAMQKK LKGTEDELDKYSEALKDAQEKLELAEKKAADAEAEVASLNRRIQLVEEEL DRAQERLATALQKLEEAEKAADESERGMKVIENRALKDEEKMELQEIQLK EAKHIAEEADRKYEEVARKLVIIEGDLERTEERAELAESKCSELEEELKN VTNNLKSLEAQAEKYSQKEDKYEEEIKILTDKLKEAETRAEFAERSVAKL EKTIDDLE
Protein Length Protein fragment
Cellular Localization PDGFR beta: Membrane.
Tropomyosin 3: Cytoplasm > cytoskeleton.

Storage & Shipping

Shipping and Storage Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.
pH: 7.50Constituents: 0.79% Tris HCl, 0.87% Sodium chloride, 0.31% Glutathione, 0.003% EDTA, 0.004% DTT, 0.002% PMSF, 25% Glycerol (glycerin, glycerine)
This product is an active protein and may elicit a biological response in vivo, handle with caution.

For research use only. Not for clinical use.