Recombinant Human HDAC1 Protein (RMPP-00230591)
Cat. No.: RMPP-00230591
Category: Recombinant Protein
Research Area: Cell Biology
INQUIRY
50 μg
Customer Size
Product Features
| Source | E.coli |
|---|---|
| Purity | > 95% SDS-PAGE. |
| Nature | Recombinant |
| Animal Free | No |
| Tags | His tag N-Terminus |
| Form | Liquid |
| Applications | SDS-PAGE |
| Key Features | Expression system: E.coli; Purity: > 95% SDS-PAGE; Tags: His tag N-Terminus; Suitable for: SDS-PAGE |
Protein Information
| UniProt ID | P04271 |
|---|---|
| Molecular Weight | 10 kDa |
| Sequence | SELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQ EVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE |
| Sequence Similarities | Belongs to the S-101 family. Contains 2 EF-hand domains. |
| Protein Length | Full length protein |
| Cellular Localization | Cytoplasm. Nucleus. |
| Tissue Specificity | Although predominant among the water-soluble brain proteins, S100 is also found in a variety of other tissues. |
| Function | Weakly binds calcium but binds zinc very tightly-distinct binding sites with different affinities exist for both ions on each monomer. Physiological concentrations of potassium ion antagonize the binding of both divalent cations, especially affecting high-affinity calcium-binding sites. Binds to and initiates the activation of STK38 by releasing autoinhibitory intramolecular interactions within the kinase. Interaction with AGER after myocardial infarction may play a role in myocyte apoptosis by activating ERK1/2 and p53/TP53 signaling. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. Constituent: 50% Glycerol (glycerin, glycerine) |
|---|
For research use only. Not for clinical use.
