Recombinant Human Hex Protein (RMPP-00230886)
Cat. No.: RMPP-00230886
Category: Recombinant Protein
Research Area: Cardiovascular
INQUIRY
20 μg
Customer Size
Product Features
| Source | E.coli |
|---|---|
| Purity | > 95% SDS-PAGE. |
| Nature | Recombinant |
| Animal Free | No |
| Form | Liquid |
| Applications | SDS-PAGE; sELISA |
| Key Features | Expression system: E.coli; Purity: > 95% SDS-PAGE; Suitable for: SDS-PAGE, Sandwich ELISA |
Protein Information
| UniProt ID | P14151 |
|---|---|
| Molecular Weight | 20 kDa including tags |
| Sequence | QCQYVVQCEPLEAPELGTMDCIHPLGNFSFQSKCAFNCSEGRELLGTAET QCGASGNWSSPEPICQVVQCEPLEAPELGTMDCIHPLGNFSFQSKCAFNC SEGRELLGTAETQCGASGNWSSPEPICQETNRSFSKIKEGDYN |
| Sequence Similarities | Belongs to the selectin/LECAM family. Contains 1 C-type lectin domain. Contains 1 EGF-like domain. Contains 2 Sushi (CCP/SCR) domains. |
| Protein Length | Protein fragment |
| Cellular Localization | Membrane. |
| Tissue Specificity | Expressed in B cell lines and T lymphocytes. |
| Function | Cell surface adhesion protein. Mediates the adherence of lymphocytes to endothelial cells of high endothelial venules in peripheral lymph nodes. Promotes initial tethering and rolling of leukocytes in endothelia. |
Storage & Shipping
| Shipping and Storage | Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle. pH: 8.00Constituents: 0.29% Sodium chloride, 0.01% EDTA, 0.61% Tris, 1% Glycine, 8.7% DL-Arginine, 0.01% Glutathione, 0.1% Oxidized Glutathione (GSSG), 10% Glycerol |
|---|
For research use only. Not for clinical use.
