Recombinant Human HIRIP3 Protein (RMPP-00230327)
Cat. No.: RMPP-00230327
Category: Growth Factors & Cytokines
Research Area: Signal Transduction
INQUIRY
10 μg
Customer Size
Product Features
| Source | E.coli |
|---|---|
| Purity | > 95% SDS-PAGE. |
| Nature | Recombinant |
| Endotoxin Level | ≤ 1.000 Eu/µg |
| Animal Free | No |
| Form | Lyophilized |
| Applications | Functional Studies; SDS-PAGE |
| Key Features | Expression system: E.coli; Purity: > 95% SDS-PAGE; Endotoxin level: ≤ 1.000 Eu/µg; Active: Yes; Suitable for: Functional Studies, SDS-PAGE |
Protein Information
| UniProt ID | P01344 |
|---|---|
| Molecular Weight | 7 kDa |
| Sequence | AYGPGETLCGGELVDTLQFVCSDRGFYFSRPSSRANRRSRGIVEECCFRS CDLALLETYCATPAKSE |
| Sequence Similarities | Belongs to the insulin family. |
| Protein Length | Full length protein |
| Cellular Localization | Secreted. |
| Function | The insulin-like growth factors possess growth-promoting activity. In vitro, they are potent mitogens for cultured cells. IGF-II is influenced by placental lactogen and may play a role in fetal development.Preptin undergoes glucose-mediated co-secretion with insulin, and acts as physiological amplifier of glucose-mediated insulin secretion. Exhibits osteogenic properties by increasing osteoblast mitogenic activity through phosphoactivation of MAPK1 and MAPK3. |
| Involvement in Disease | Epigenetic changes of DNA hypomethylation in IGF2 are a cause of Silver-Russell syndrome (SIRS). SIRS is a clinically heterogeneous condition characterized by severe intrauterine growth retardation, poor postnatal growth, craniofacial features such as a triangular shaped face and a broad forehead, body asymmetry, and a variety of minor malformations. |
| Post-translational Modifications | O-glycosylated with a core 1 or possibly core 8 glycan. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Store at -20°C. Avoid freeze / thaw cycle. Constituent: 0.1% Trifluoroacetic acidLyophilized from a sterile (0.2 micron) filtered aqueous solution. This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.