Recombinant Human IFNGR1 Protein (RMPP-00230882)
Cat. No.: RMPP-00230882
Category: Growth Factors & Cytokines
Research Area: Cardiovascular
INQUIRY
200 μg
Customer Size
Product Features
| Source | HEK 293 cells |
|---|---|
| Purity | ≥ 95% SDS-PAGE. Purity by HPLC ≥95%. |
| Nature | Recombinant |
| Endotoxin Level | < 0.005 Eu/µg |
| Carrier Free | Yes |
| Animal Free | Yes |
| Form | Lyophilized |
| Applications | SDS-PAGE; HPLC; Functional Studies; Cell Culture |
| Key Features | Expression system: HEK 293 cells; Purity: ≥ 95% SDS-PAGE; Endotoxin level: < 0.005 Eu/µg; Active: Yes; Suitable for: SDS-PAGE, MS, HPLC, Functional Studies, Cell Culture |
Protein Information
| UniProt ID | P10145 |
|---|---|
| Molecular Weight | 8 kDa |
| Molecular Weight Information | M +/- 0 Da (Calc mass 8356 Da) |
| Sequence | AKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCL DPKENWVQRVVEKFLKRAENS |
| Sequence Similarities | Belongs to the intercrine alpha (chemokine CxC) family. |
| Protein Length | Full length protein |
| Cellular Localization | Secreted. |
| Function | IL-8 is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus. IL-8(6-77) has a 5-10-fold higher activity on neutrophil activation, IL-8(5-77) has increased activity on neutrophil activation and IL-8(7-77) has a higher affinity to receptors CXCR1 and CXCR2 as compared to IL-8(1-77), respectively. |
| Post-translational Modifications | Several N-terminal processed forms are produced by proteolytic cleavage after secretion from at least peripheral blood monocytes, leukcocytes and endothelial cells. In general, IL-8(1-77) is referred to as interleukin-8. IL-8(6-77) is the most promiment form. |
Storage & Shipping
| Shipping and Storage | Shipped at Room Temperature. Store at Room Temperature. pH: 6.00Constituents: 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Monobasic dihydrogen potassium phosphate, 10.26% TrehaloseBuffer lyophilized from. This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.
