Recombinant Human IGF1 Protein (Active) (RMPP-00230146)
Cat. No.: RMPP-00230146
Category: Recombinant Protein
Research Area: Signal Transduction
INQUIRY
100 μg
250 µg
Product Features
| Source | Wheat germ |
|---|---|
| Nature | Recombinant |
| Animal Free | No |
| Form | Liquid |
| Applications | ELISA; WB; SDS-PAGE |
| Key Features | Expression system: Wheat germ; Suitable for: ELISA, WB, SDS-PAGE |
Protein Information
| UniProt ID | Q9NPG1 |
|---|---|
| Molecular Weight | 37 kDa including tags |
| Sequence | QQTAALAMEPFHPMVNLDCSRDFRPFLCALYAPICMEYGRVTLPCRRLCQ RAYSECSKLMEMFGVPWPEDMECSRFPDCDEPYPRLVDLNLAGEPTEGAP VAV |
| Sequence Similarities | Belongs to the G-protein coupled receptor Fz/Smo family. Contains 1 FZ (frizzled) domain. |
| Protein Length | Protein fragment |
| Cellular Localization | Membrane. Cell membrane. |
| Tissue Specificity | Widely expressed. Relatively high expression in the CNS, including regions of the limbic system, in kidney, pancreas, skeletal muscle, uterus and testis. |
| Domain | Lys-Thr-X-X-X-Trp motif interacts with the PDZ doman of Dvl (Disheveled) family members and is involved in the activation of the Wnt/beta-catenin signaling pathway.The FZ domain is involved in binding with Wnt ligands. |
| Function | Receptor for Wnt proteins. Most of frizzled receptors are coupled to the beta-catenin canonical signaling pathway, which leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin and activation of Wnt target genes. A second signaling pathway involving PKC and calcium fluxes has been seen for some family members, but it is not yet clear if it represents a distinct pathway or if it can be integrated in the canonical pathway, as PKC seems to be required for Wnt-mediated inactivation of GSK-3 kinase. Both pathways seem to involve interactions with G-proteins. May be involved in transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues. |
Storage & Shipping
| Shipping and Storage | Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles. pH: 8.00Constituents: 0.31% Glutathione, 0.79% Tris HCl |
|---|
For research use only. Not for clinical use.
