Recombinant Human IL-6R Protein (RMPP-00230571)
Cat. No.: RMPP-00230571
Category: Recombinant Protein
Research Area: Immunology
INQUIRY
100 μg
50 μg
Product Features
| Source | E.coli |
|---|---|
| Purity | > 90% SDS-PAGE. |
| Nature | Recombinant |
| Animal Free | No |
| Tags | His tag N-Terminus, T7 tag N-Terminus |
| Form | Liquid |
| Applications | SDS-PAGE |
| Key Features | Expression system: E.coli; Purity: > 90% SDS-PAGE; Endotoxin level: = 5.000 Eu/µg; Tags: His tag N-Terminus, T7 tag N-Terminus; Suitable for: SDS-PAGE |
Protein Information
| UniProt ID | P13987 |
|---|---|
| Molecular Weight | 12 kDa including tags |
| Sequence | MASMTGGQQMGRGHHHHHHGNLYFQGGEFALVQCYNCPNPTADCKTAVNC SSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLC NFNEQLEN |
| Sequence Similarities | Contains 1 UPAR/Ly6 domain. |
| Protein Length | Full length protein |
| Cellular Localization | Cell membrane. Secreted. Soluble form found in a number of tissues. |
| Function | Potent inhibitor of the complement membrane attack complex (MAC) action. Acts by binding to the C8 and/or C9 complements of the assembling MAC, thereby preventing incorporation of the multiple copies of C9 required for complete formation of the osmolytic pore. This inhibitor appears to be species-specific. Involved in signal transduction for T-cell activation complexed to a protein tyrosine kinase.The soluble form from urine retains its specific complement binding activity, but exhibits greatly reduced ability to inhibit MAC assembly on cell membranes. |
| Involvement in Disease | Defects in CD59 are the cause of CD59 deficiency (CD59D). |
| Post-translational Modifications | N- and O-glycosylated. The N-glycosylation mainly consists of a family of biantennary complex-type structures with and without lactosamine extensions and outer arm fucose residues. Also significant amounts of triantennary complexes (22%). Variable sialylation also present in the Asn-43 oligosaccharide. The predominant O-glycans are mono-sialylated forms of the disaccharide, Gal-beta-1,3GalNAc, and their sites of attachment are probably on Thr-76 and Thr-77. The GPI-anchor of soluble urinary CD59 has no inositol-associated phospholipid, but is composed of seven different GPI-anchor variants of one or more monosaccharide units. Major variants contain sialic acid, mannose and glucosamine Sialic acid linked to an N-acetylhexosamine-galactose arm is present in two variants.Glycated. Glycation is found in diabetic subjects, but only at minimal levels in nondiabetic subjects. Glycated CD59 lacks MAC-inhibitory function and confers to vascular complications of diabetes. |
Storage & Shipping
| Shipping and Storage | Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle. pH: 8.00Constituent: 0.32% Tris HClProprietary formulation of NaCl, KCl, EDTA, Arginine, DTT and Glycerol. |
|---|
For research use only. Not for clinical use.