Recombinant Human Integrin alpha 5 Protein (RMPP-00231011)
Cat. No.: RMPP-00231011
Category: Recombinant Protein
Research Area: Epigenetics and Nuclear Signaling
INQUIRY
10 μg
Customer Size
Product Features
| Source | E.coli |
|---|---|
| Purity | > 75% Affinity purified. Purified by an affinity column in combination with FPLC chromatography. |
| Nature | Recombinant |
| Animal Free | No |
| Tags | His tag C-Terminus |
| Form | Liquid |
| Applications | WB; SDS-PAGE |
| Key Features | Expression system: E.coli; Purity: > 75% Affinity purified; Tags: His tag C-Terminus; Suitable for: WB, SDS-PAGE |
Protein Information
| UniProt ID | P01106 |
|---|---|
| Molecular Weight | 50 kDa |
| Sequence | MPLNVSFTNRNYDLDYDSVQPYFYCDEEE NFYQQQQQSELQPPAPSEDIWKKFELLPTPPLSPSRRSGLCSPSYVAVTP FSLRGDND GGGGSFSTADQLEMVTELLGGDMVNQSFICDPDDETFIKNIIIQDCMWSG FSAAAKLV SEKLASYQAARKDSGSPNPARGHSVCSTSSLYLQDLSAAASECIDPSVVF PYPLNDSS SPKSCASQDSSAFSPSSDSLLSSTESSPQGSPEPLVLHEETPPTTSSDSE EEQEDEEE IDVVSVEKRQAPGKRSESGSPSAGGHSKPPHSPLVLKRCHVSTHQHNYAA PPSTRKDY PAAKRVKLDSVRVLRQISNNRKCTSPRSSDTEENVKRRTHNVLERQRRNE LKRSFFAL RDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLLRKRREQL KHKLEQLR NSCA |
| Sequence Similarities | Contains 1 basic helix-loop-helix (bHLH) domain. |
| Protein Length | Full length protein |
| Cellular Localization | Nucleus > nucleoplasm. Nucleus > nucleolus. |
| Function | Participates in the regulation of gene transcription. Binds DNA in a non-specific manner, yet also specifically recognizes the core sequence 5'-CACTG-3'. Seems to activate the transcription of growth-related genes. |
| Involvement in Disease | Note=Overexpression of MYC is implicated in the etiology of a variety of hematopoietic tumors.Note=A chromosomal aberration involving MYC may be a cause of a form of B-cell chronic lymphocytic leukemia. Translocation t(8;12)(q24;q22) with BTG1.Defects in MYC are a cause of Burkitt lymphoma (BL). A form of undifferentiated malignant lymphoma commonly manifested as a large osteolytic lesion in the jaw or as an abdominal mass. Note=Chromosomal aberrations involving MYC are usually found in Burkitt lymphoma. Translocations t(8;14), t(8;22) or t(2;8) which juxtapose MYC to one of the heavy or light chain immunoglobulin gene loci. |
| Post-translational Modifications | Phosphorylated by PRKDC. Phosphorylation at Thr-58 and Ser-62 by GSK3 is required for ubiquitination and degradation by the proteasome.Ubiquitinated by the SCF(FBXW7) complex when phosphorylated at Thr-58 and Ser-62, leading to its degradation by the proteasome. In the nucleoplasm, ubiquitination is counteracted by USP28, which interacts with isoform 1 of FBXW7 (FBW7alpha), leading to its deubiquitination and preventing degradation. In the nucleolus, however, ubiquitination is not counteracted by USP28, due to the lack of interaction between isoform 4 of FBXW7 (FBW7gamma) and USP28, explaining the selective MYC degradation in the nucleolus. Also polyubiquitinated by the DCX(TRUSS) complex. |
Storage & Shipping
| Shipping and Storage | Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle. pH: 7.9Constituents: Potassium chloride, 0.0154% DTT, Tris HCl, EDTA, 20% GlycerolProtein is stored in 20 mM Tris-Cl (pH 7.5), 20% Glycerol, 100 mM KCl, 1 mM DTT and 0.2 mM EDTA. |
|---|
For research use only. Not for clinical use.
