Recombinant Human LAMP2 Protein (RMPP-00230370)
Cat. No.: RMPP-00230370
Category: Growth Factors & Cytokines
Research Area: Immunology
INQUIRY
10 μg
Customer Size
Product Features
| Source | E.coli |
|---|---|
| Purity | ≥ 95% SDS-PAGE. |
| Nature | Recombinant |
| Endotoxin Level | ≤ 1.000 Eu/µg |
| Animal Free | No |
| Form | Lyophilized |
| Applications | Functional Studies; SDS-PAGE |
| Key Features | Expression system: E.coli; Purity: ≥ 95% SDS-PAGE; Endotoxin level: ≤ 1.000 Eu/µg; Active: Yes; Suitable for: Functional Studies, SDS-PAGE |
Protein Information
| UniProt ID | P08700 |
|---|---|
| Molecular Weight | 16 kDa |
| Sequence | MISDRGSDAHHLLRTLDCRTIALEILVKLPYPQVSGLNNSDDKANLRNST LRRVNLDEFLKSQEEFDSQDTTDIKSKLQKLKCCIPAAASDSVLPGVYNK DLDDFKKKLRFYVIHLKDLQPVSVSRPPQPTSSSDNFRPMTVEC |
| Sequence Similarities | Belongs to the IL-3 family. |
| Protein Length | Full length protein |
| Cellular Localization | Secreted. |
| Tissue Specificity | Activated T-cells, mast cells, natural killer cells. |
| Function | Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages.This CSF induces granulocytes, macrophages, mast cells, stem cells, erythroid cells, eosinophils and megakaryocytes. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Store at -20°C. Constituent: 0.1% Trifluoroacetic acidLyophilized from a sterile (0.2 micron) filtered aqueous solution. This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.
