Banner

Recombinant Human LAMP2 Protein (RMPP-00230370)

Cat. No.: RMPP-00230370

Category: Growth Factors & Cytokines

Research Area: Immunology

INQUIRY 10 μg Customer Size

Product Features

Source E.coli
Purity ≥ 95% SDS-PAGE.
Nature Recombinant
Endotoxin Level ≤ 1.000 Eu/µg
Animal Free No
Form Lyophilized
Applications Functional Studies; SDS-PAGE
Key Features Expression system: E.coli; Purity: ≥ 95% SDS-PAGE; Endotoxin level: ≤ 1.000 Eu/µg; Active: Yes; Suitable for: Functional Studies, SDS-PAGE

Protein Information

UniProt ID P08700
Molecular Weight 16 kDa
Sequence MISDRGSDAHHLLRTLDCRTIALEILVKLPYPQVSGLNNSDDKANLRNST LRRVNLDEFLKSQEEFDSQDTTDIKSKLQKLKCCIPAAASDSVLPGVYNK DLDDFKKKLRFYVIHLKDLQPVSVSRPPQPTSSSDNFRPMTVEC
Sequence Similarities Belongs to the IL-3 family.
Protein Length Full length protein
Cellular Localization Secreted.
Tissue Specificity Activated T-cells, mast cells, natural killer cells.
Function Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages.This CSF induces granulocytes, macrophages, mast cells, stem cells, erythroid cells, eosinophils and megakaryocytes.

Storage & Shipping

Shipping and Storage Shipped at 4°C. Store at -20°C.
Constituent: 0.1% Trifluoroacetic acidLyophilized from a sterile (0.2 micron) filtered aqueous solution.
This product is an active protein and may elicit a biological response in vivo, handle with caution.

For research use only. Not for clinical use.