Banner

Recombinant Human MCP1 Protein (Active)

Recombinant Human MCP1 Protein (Active) (RMPP-00230150)

Cat. No.: RMPP-00230150

Category: Recombinant Protein

Research Area: Epigenetics and Nuclear Signaling

INQUIRY 100 μg 250 µg

Product Features

Source Wheat germ
Nature Recombinant
Animal Free No
Tags GST tag N-Terminus
Form Liquid
Applications ELISA; WB; SDS-PAGE
Key Features Expression system: Wheat germ; Tags: GST tag N-Terminus; Suitable for: ELISA, WB, SDS-PAGE

Protein Information

UniProt ID P15173
Molecular Weight 51 kDa including tags
Sequence MELYETSPYFYQEPRFYDGENYLPVHLQGFEPPGYERTELTLSPEAPGPL EDKGLGTPEHCPGQCLPWACKVCKRKSVSVDRRRAATLREKRRLKKVNEA FEALKRSTLLNPNQRLPKVEILRSAIQYIERLQALLSSLNQEERDLRYRG GGGPQPGVPSECSSHSASCSPEWGSALEFSANPGDHLLTADPTDAHNLHS LTSIVDSITVEDVSVAFPDETMPN
Sequence Similarities Contains 1 basic helix-loop-helix (bHLH) domain.
Protein Length Full length protein
Cellular Localization Nucleus.
Function Involved in muscle differentiation (myogenic factor). Induces fibroblasts to differentiate into myoblasts. Probable sequence specific DNA-binding protein.

Storage & Shipping

Shipping and Storage Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
pH: 8.00Constituents: 0.3% Glutathione, 0.79% Tris HCl

For research use only. Not for clinical use.