Recombinant Human MELK (mutated T460M) Protein (RMPP-00230541)
Cat. No.: RMPP-00230541
Category: Recombinant Protein
Research Area: Signal Transduction
INQUIRY
5 μg
10 μg
Product Features
| Source | E.coli |
|---|---|
| Purity | > 85% SDS-PAGE. |
| Nature | Recombinant |
| Animal Free | No |
| Tags | His tag N-Terminus |
| Form | Liquid |
| Applications | MS; SDS-PAGE |
| Key Features | Expression system: E.coli; Purity: > 85% SDS-PAGE; Tags: His tag N-Terminus; Suitable for: MS, SDS-PAGE |
Protein Information
| UniProt ID | P62736 |
|---|---|
| Molecular Weight | 44 kDa including tags |
| Sequence | MGSSHHHHHHSSGLVPRGSHMGSHMEEEDSTALVCDNGSGLCKAGFAGDD APRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI ITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFE TFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAI MRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFEN EMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIH ETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTM KIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF |
| Sequence Similarities | Belongs to the actin family. |
| Protein Length | Full length protein |
| Cellular Localization | Cytoplasm > cytoskeleton. |
| Function | Actins are highly conserved proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells. |
| Involvement in Disease | Defects in ACTA2 are the cause of aortic aneurysm familial thoracic type 6 (AAT6). AATs are characterized by permanent dilation of the thoracic aorta usually due to degenerative changes in the aortic wall. They are primarily associated with a characteristic histologic appearance known as 'medial necrosis' or 'Erdheim cystic medial necrosis' in which there is degeneration and fragmentation of elastic fibers, loss of smooth muscle cells, and an accumulation of basophilic ground substance. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. pH: 8.00Constituents: 0.32% Tris HCl, 10% Glycerol (glycerin, glycerine), 0.88% Sodium chloride |
|---|
For research use only. Not for clinical use.
