Recombinant Human MNDA Protein (RMPP-00230869)
Cat. No.: RMPP-00230869
Category: Recombinant Protein
Research Area: Neuroscience
INQUIRY
100 μg
Customer Size
Product Features
| Source | E.coli |
|---|---|
| Purity | > 90% SDS-PAGE. |
| Nature | Recombinant |
| Animal Free | No |
| Tags | His tag N-Terminus |
| Form | Liquid |
| Applications | SDS-PAGE; MS |
| Key Features | Expression system: E.coli; Purity: > 90% SDS-PAGE; Tags: His tag N-Terminus; Suitable for: SDS-PAGE, MS |
Protein Information
| UniProt ID | Q9UI15 |
|---|---|
| Molecular Weight | 25 kDa including tags |
| Sequence | MGSSHHHHHHSSGLVPRGSHMANRGPSYGLSREVQEKIEQKYDADLENKL VDWIILQCAEDIEHPPPGRAHFQKWLMDGTVLCKLINSLYPPGQEPIPKI SESKMAFKQMEQISQFLKAAETYGVRTTDIFQTVDLWEGKDMAAVQRTLM ALGSVAVTKDDGCYRGEPSWFHRKAQQNRRGFSEEQLRQGQNVIGLQMGS NKGASQAGMTGYGMPRQIM |
| Sequence Similarities | Belongs to the calponin family. Contains 1 calponin-like repeat. Contains 1 CH (calponin-homology) domain. |
| Protein Length | Full length protein |
| Tissue Specificity | Widely expressed in the brain. Expression is increased in the superior frontal cortex of alcoholics, but not in the motor cortex or cerebellum. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. pH: 8.00Constituents: 0.02% DTT, 0.32% Tris HCl, 20% Glycerol (glycerin, glycerine) |
|---|
For research use only. Not for clinical use.
