Recombinant Human Neurotrophin 3 Protein (Animal Free) (RMPP-00230867)
Cat. No.: RMPP-00230867
Category: Recombinant Protein
Research Area: Neuroscience
INQUIRY
2 μg
Customer Size
Product Features
| Source | E.coli |
|---|---|
| Purity | > 90% SDS-PAGE. |
| Nature | Recombinant |
| Animal Free | No |
| Tags | His tag N-Terminus |
| Form | Liquid |
| Applications | SDS-PAGE; MS |
| Key Features | Expression system: E.coli; Purity: > 90% SDS-PAGE; Tags: His tag N-Terminus; Suitable for: SDS-PAGE, MS |
Protein Information
| UniProt ID | P62258 |
|---|---|
| Molecular Weight | 31 kDa including tags |
| Sequence | MGSSHHHHHHSSGLVPRGSHMDDREDLVYQAKLAEQAERYDEMVESMKKV AGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLK MIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHR YLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVF YYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTL WTSDMQGDGEEQNKEALQDVEDENQ |
| Sequence Similarities | Belongs to the 14-3-3 family. |
| Protein Length | Full length protein |
| Cellular Localization | Cytoplasm. Melanosome. Identified by mass spectrometry in melanosome fractions from stage I to stage IV. |
| Function | Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathway. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. pH: 7.40Constituents: 10% Glycerol (glycerin, glycerine), 0.02% DTT, 89% PBS |
|---|
For research use only. Not for clinical use.
