Banner

Recombinant Human NKp30 Protein (Fc Chimera Active)

Recombinant Human NKp30 Protein (Fc Chimera Active) (RMPP-00230361)

Cat. No.: RMPP-00230361

Category: Recombinant Protein

Research Area: Cardiovascular

INQUIRY 100 μg Customer Size

Product Features

Source HEK 293 cells
Purity ≥ 90% SDS-PAGE.
Nature Recombinant
Endotoxin Level < 0.100 Eu/µg
Animal Free No
Tags DDDDK tag N-Terminus
Form Lyophilized
Applications Functional Studies; SDS-PAGE
Key Features Expression system: HEK 293 cells; Purity: ≥ 90% SDS-PAGE; Endotoxin level: < 0.100 Eu/µg; Active: Yes; Tags: DDDDK tag N-Terminus; Suitable for: Functional Studies, SDS-PAGE

Protein Information

UniProt ID Q15848
Molecular Weight 33 kDa including tags
Sequence ETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEK GDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVG LETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYM KDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGE GERNGLYADNDNDSTFTGFLLYHDTN
Sequence Similarities Contains 1 C1q domain. Contains 1 collagen-like domain.
Protein Length Full length protein
Cellular Localization Secreted.
Tissue Specificity Synthesized exclusively by adipocytes and secreted into plasma.
Domain The C1q domain is commonly called the globular domain.
Function Important adipokine involved in the control of fat metabolism and insulin sensitivity, with direct anti-diabetic, anti-atherogenic and anti-inflammatory activities. Stimulates AMPK phosphorylation and activation in the liver and the skeletal muscle, enhancing glucose utilization and fatty-acid combustion. Antagonizes TNF-alpha by negatively regulating its expression in various tissues such as liver and macrophages, and also by counteracting its effects. Inhibits endothelial NF-kappa-B signaling through a cAMP-dependent pathway. May play a role in cell growth, angiogenesis and tissue remodeling by binding and sequestering various growth factors with distinct binding affinities, depending on the type of complex, LMW, MMW or HMW.
Involvement in Disease Defects in ADIPOQ are the cause of adiponectin deficiency (ADPND). ADPND results in very low concentrations of plasma adiponectin.Genetic variations in ADIPOQ are associated with non-insulin-dependent diabetes mellitus (NIDDM); also known as diabetes mellitus type 2. NIDDM is characterized by an autosomal dominant mode of inheritance, onset during adulthood and insulin resistance.
Post-translational Modifications Hydroxylated Lys-33 was not identified in PubMed:16497731, probably due to poor representation of the N-terminal peptide in mass fingerprinting.HMW complexes are more extensively glycosylated than smaller oligomers. Hydroxylation and glycosylation of the lysine residues within the collagene-like domain of adiponectin seem to be critically involved in regulating the formation and/or secretion of HMW complexes and consequently contribute to the insulin-sensitizing activity of adiponectin in hepatocytes.O-glycosylated. Not N-glycosylated. O-linked glycans on hydroxylysines consist of Glc-Gal disaccharides bound to the oxygen atom of post-translationally added hydroxyl groups. Sialylated to varying degrees depending on tissue. Thr-22 appears to be the major site of sialylation. Higher sialylation found in SGBS adipocytes than in HEK fibroblasts. Sialylation is not required neither for heterodimerization nor for secretion. Not sialylated on the glycosylated hydroxylysines. Desialylated forms are rapidly cleared from the circulation.

Storage & Shipping

Shipping and Storage Shipped at 4°C. Store at -20°C.
Constituent: 99% PBS
This product is an active protein and may elicit a biological response in vivo, handle with caution.

For research use only. Not for clinical use.