Recombinant Human PREI3 Protein (RMPP-00230859)
Cat. No.: RMPP-00230859
Category: Recombinant Protein
Research Area: Neuroscience
INQUIRY
50 μg
250 µg
Product Features
| Source | E.coli |
|---|---|
| Purity | > 90% SDS-PAGE. |
| Nature | Recombinant |
| Animal Free | No |
| Tags | His tag N-Terminus |
| Form | Liquid |
| Applications | SDS-PAGE; MS |
| Key Features | Expression system: E.coli; Purity: > 90% SDS-PAGE; Tags: His tag N-Terminus; Suitable for: SDS-PAGE, MS |
Protein Information
| UniProt ID | Q99784 |
|---|---|
| Molecular Weight | 14 kDa including tags |
| Sequence | MGSSHHHHHHSSGLVPRGSHMGSLPTNPEESWQVYSSAQDSEGRCICTVV APQQTMCSRDARTKQLRQLLEKVQNMSQSIEVLDRRTQRDLQYVEKMENQ MKGLESKFKQVEESHKQHLARQFKG |
| Sequence Similarities | Contains 1 olfactomedin-like domain. |
| Protein Length | Full length protein |
| Cellular Localization | Endoplasmic reticulum lumen. |
| Function | Seems to play an important role in regulating the production of neural crest cells by the neural tube. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. pH: 7.50Constituents: 0.08% DTT, 0.32% Tris HCl, 50% Glycerol (glycerin, glycerine), 1.17% Sodium chloride |
|---|
For research use only. Not for clinical use.
