Recombinant Human RSPO1 Protein

Products

Online Inquiry

Recombinant Human RSPO1 Protein (RMPP-00230738)

Cat. No.: RMPP-00230738

Category: Recombinant Protein

Research Area: Signal Transduction

INQUIRY 50 μg Customer Size

Product Features

Source	HEK 293 cells
Purity	> 90% SDS-PAGE.
Nature	Recombinant
Endotoxin Level	< 1.000 Eu/µg
Animal Free	No
Tags	His tag C-Terminus
Form	Lyophilized
Applications	SDS-PAGE; Functional Studies
Key Features	Expression system: HEK 293 cells; Purity: > 90% SDS-PAGE; Endotoxin level: < 1.000 Eu/µg; Active: Yes; Tags: His tag C-Terminus; Suitable for: SDS-PAGE, Functional Studies

Protein Information

UniProt ID	P49747
Molecular Weight	82 kDa including tags
Sequence	QGQSPLGSDLGPQMLRELQETNAALQDVRELLRQQVREITFLKNTVMECD ACGMQQSVRTGLPSVRPLLHCAPGFCFPGVACIQTESGARCGPCPAGFTG NGSHCTDVNECNAHPCFPRVRCINTSPGFRCEACPPGYSGPTHQGVGLAF AKANKQVCTDINECETGQHNCVPNSVCINTRGSFQCGPCQPGFVGDQASG CQRRAQRFCPDGSPSECHEHADCVLERDGSRSCVCAVGWAGNGILCGRDT DLDGFPDEKLRCPERQCRKDNCVTVPNSGQEDVDRDGIGDACDPDADGDG VPNEKDNCPLVRNPDQRNTDEDKWGDACDNCRSQKNDDQKDTDQDGRGDA CDDDIDGDRIRNQADNCPRVPNSDQKDSDGDGIGDACDNCPQKSNPDQAD VDHDFVGDACDSDQDQDGDGHQDSRDNCPTVPNSAQEDSDHDGQGDACDD DDDNDGVPDSRDNCRLVPNPGQEDADRDGVGDVCQDDFDADKVVDKIDVC PENAEVTLTDFRAFQTVVLDPEGDAQIDPNWVVLNQGREIVQTMNSDPGL AVGYTAFNGVDFEGTFHVNTVTDDDYAGFIFGYQDSSSFYVVMWKQMEQT YWQANPFRAVAEPGIQLKAVKSSTGPGEQLRNALWHTGDTESQVRLLWKD PRNVGWKDKKSYRWFLQHRPQVGYIRVRFYEGPELVADSNVVLDTTMRGG RLGVFCFSQENIIWANLRYRCNDTIPEDYETHQLRQA
Sequence Similarities	Belongs to the thrombospondin family. Contains 4 EGF-like domains. Contains 1 TSP C-terminal (TSPC) domain. Contains 8 TSP type-3 repeats.
Protein Length	Full length protein
Cellular Localization	Secreted > extracellular space > extracellular matrix.
Tissue Specificity	Abundantly expressed in the chondrocyte extracellular matrix, and is also found in bone, tendon, ligament and synovium and blood vessels. Increased amounts are produced during late stages of osteoarthritis in the area adjacent to the main defect.
Developmental Stage	Present during the earliest stages of limb maturation and is later found in regions where the joints develop.
Domain	The cell attachment motif mediates the attachment to chondrocytes. It mediates the induction of both the IAP family of survival proteins and the antiapoptotic response.The TSP C-terminal domain mediates interaction with FN1 and ACAN.
Function	May play a role in the structural integrity of cartilage via its interaction with other extracellular matrix proteins such as the collagens and fibronectin. Can mediate the interaction of chondrocytes with the cartilage extracellular matrix through interaction with cell surface integrin receptors. Could play a role in the pathogenesis of osteoarthritis. Potent suppressor of apoptosis in both primary chondrocytes and transformed cells. Suppresses apoptosis by blocking the activation of caspase-3 and by inducing the IAP family of survival proteins (BIRC3, BIRC2, BIRC5 and XIAP). Essential for maintaining a vascular smooth muscle cells (VSMCs) contractile/differentiated phenotype under physiological and pathological stimuli. Maintains this phenotype of VSMCs by interacting with ITGA7.
Involvement in Disease	Defects in COMP are the cause of multiple epiphyseal dysplasia type 1 (EDM1). EDM is a generalized skeletal dysplasia associated with significant morbidity. Joint pain, joint deformity, waddling gait, and short stature are the main clinical signs and symptoms. EDM is broadly categorized into the more severe Fairbank and the milder Ribbing types.Defects in COMP are the cause of pseudoachondroplasia (PSACH). PSAC is a dominantly inherited chondrodysplasia characterized by short stature and early-onset osteoarthrosis. PSACH is more severe than EDM1 and is recognized in early childhood.

Storage & Shipping

Shipping and Storage	Shipped at 4°C. Store at 4°C prior to reconstitution. Upon reconsitution add a carrier protein (0.1% BSA). Store at -20°C or -80°C. Avoid freeze / thaw cycle. pH: 7.4Constituents: 0.6% Tris, 0.58% Sodium chloride, 3% Trehalose5-10% trehalose is commonly used for freeze drying, and after reconstitution, the trehalose is mostly about 3-5% This product is an active protein and may elicit a biological response in vivo, handle with caution.

Shipping and Storage

Shipped at 4°C. Store at 4°C prior to reconstitution. Upon reconsitution add a carrier protein (0.1% BSA). Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 7.4Constituents: 0.6% Tris, 0.58% Sodium chloride, 3% Trehalose5-10% trehalose is commonly used for freeze drying, and after reconstitution, the trehalose is mostly about 3-5%
This product is an active protein and may elicit a biological response in vivo, handle with caution.

For research use only. Not for clinical use.