Recombinant Human SDF1 beta Protein (Animal Free) (RMPP-00230927)
Cat. No.: RMPP-00230927
Category: Recombinant Protein
Research Area: Cardiovascular
INQUIRY
2 μg
Customer Size
Product Features
| Source | Wheat germ |
|---|---|
| Purity | ≥ 80% Purified via GST Tag. Glutathione Sepharose |
| Nature | Recombinant |
| Animal Free | No |
| Tags | GST tag N-Terminus |
| Form | Liquid |
| Applications | SDS-PAGE; WB; ELISA |
| Key Features | Expression system: Wheat germ; Purity: ≥ 80% Purified via GST Tag; Tags: GST tag N-Terminus; Suitable for: SDS-PAGE, WB, ELISA |
Protein Information
| UniProt ID | P04275 |
|---|---|
| Molecular Weight | 56 kDa including tags |
| Sequence | MGAQDEEEGIQDLDGLLVFDKIVEVTLLNLPWYNEETEGQRGEMTAPKSP RAKIRGTLCAEGTRGRSSTARCSLFGSDFVNTFDGSMYSFAGYCSYLLAG GCQKRSFSIIGDFQNGKRVSLSVYLGEFFDIHLFVNGTVTQGDQRVSMPY ASKGLYLETEAGYYKLSGEAYGFVARIDGSGNFQVLLSDRYFNKTCGLCG NFNIFAEDDFMTQEGTLTSDPYDFANSWALSSGEQWCERASPPSSSCNIS SGEMQKVGVDWPGCTWMVCDFWI |
| Sequence Similarities | Contains 1 CTCK (C-terminal cystine knot-like) domain. Contains 4 TIL (trypsin inhibitory-like) domains. Contains 3 VWFA domains. Contains 3 VWFC domains. Contains 4 VWFD domains. |
| Protein Length | Protein fragment |
| Cellular Localization | Secreted. Secreted > extracellular space > extracellular matrix. Localized to storage granules. |
| Tissue Specificity | Plasma. |
| Domain | The von Willebrand antigen 2 is required for multimerization of vWF and for its targeting to storage granules. |
| Function | Important in the maintenance of hemostasis, it promotes adhesion of platelets to the sites of vascular injury by forming a molecular bridge between sub-endothelial collagen matrix and platelet-surface receptor complex GPIb-IX-V. Also acts as a chaperone for coagulation factor VIII, delivering it to the site of injury, stabilizing its heterodimeric structure and protecting it from premature clearance from plasma. |
| Involvement in Disease | Defects in VWF are the cause of von Willebrand disease (VWD). VWD defines a group of hemorrhagic disorders in which the von Willebrand factor is either quantitatively or qualitativelythis product resulting in altered platelet function. Symptoms vary depending on severity and disease type but may include prolonged bleeding time, deficiency of factor VIII and impaired platelet adhesion. Type I von Willebrand disease is the most common form and is characterized by partial quantitative plasmatic deficiency of an otherwise structurally and functionally normal Willebrand factor; type II is associated with a qualitative deficiency and functional anomalies of the Willebrand factor; type III is the most severe form and is characterized by total or near-total absence of Willebrand factor in the plasma and cellular compartments, also leading to a profound deficiency of plasmatic factor VIII. |
| Post-translational Modifications | All cysteine residues are involved in intrachain or interchain disulfide bonds.N- and O-glycosylated. |
Storage & Shipping
| Shipping and Storage | Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles. pH: 8.00Constituents: 0.31% Glutathione, 0.79% Tris HCl |
|---|
For research use only. Not for clinical use.
