Recombinant Human SFRP1 Protein (His tag) (RMPP-00230736)
Cat. No.: RMPP-00230736
Category: Recombinant Protein
Research Area: Cardiovascular
INQUIRY
50 μg
Customer Size
Product Features
| Source | E.coli |
|---|---|
| Purity | > 90% SDS-PAGE. |
| Nature | Recombinant |
| Animal Free | No |
| Tags | His-T7 tag N-Terminus |
| Form | Liquid |
| Applications | SDS-PAGE; Functional Studies |
| Key Features | Expression system: E.coli; Purity: > 90% SDS-PAGE; Tags: His-T7 tag N-Terminus; Suitable for: SDS-PAGE, Functional Studies |
Protein Information
| UniProt ID | P02751 |
|---|---|
| Molecular Weight | 18 kDa including tags |
| Sequence | MASMTGGQQMGRGHHHHHHGNLYFQGGEFNVSVYTVKDDKESVPISDTII PEVPQLTDLSFVDITDSSIGLRWTPLNSSTIIGYRITVVAAGEGIPIFED FVDSSVGYYTVTGLEPGIDYDISVITLINGGESAPTTLTQQTAVPPPTDL RFTNIGPDTMRVT |
| Sequence Similarities | Contains 12 fibronectin type-I domains. Contains 2 fibronectin type-II domains. Contains 16 fibronectin type-III domains. |
| Protein Length | Protein fragment |
| Cellular Localization | Secreted, extracellular space, extracellular matrix. |
| Tissue Specificity | Plasma FN (soluble dimeric form) is secreted by hepatocytes. Cellular FN (dimeric or cross-linked multimeric forms), made by fibroblasts, epithelial and other cell types, is deposited as fibrils in the extracellular matrix. Ugl-Y1, Ugl-Y2 and Ugl-Y3 are found in urine. |
| Developmental Stage | Ugl-Y1, Ugl-Y2 and Ugl-Y3 are present in the urine from 0 to 17 years of age. |
| Function | Fibronectins bind cell surfaces and various compounds including collagen, fibrin, heparin, DNA, and actin. Fibronectins are involved in cell adhesion, cell motility, opsonization, wound healing, and maintenance of cell shape. Involved in osteoblast compaction through the fibronectin fibrillogenesis cell-mediated matrix assembly process, essential for osteoblast mineralization. Participates in the regulation of type I collagen deposition by osteoblasts.Anastellin binds fibronectin and induces fibril formation. This fibronectin polymer, named superfibronectin, exhibits enhanced adhesive properties. Both anastellin and superfibronectin inhibit tumor growth, angiogenesis and metastasis. Anastellin activates p38 MAPK and inhibits lysophospholipid signaling. |
| Involvement in Disease | Glomerulopathy with fibronectin deposits 2 |
| Post-translational Modifications | Sulfated.It is not known whether both or only one of Thr-2064 and Thr-2065 are/is glycosylated.Forms covalent cross-links mediated by a transglutaminase, such as F13A or TGM2, between a glutamine and the epsilon-amino group of a lysine residue, forming homopolymers and heteropolymers (e.g. fibrinogen-fibronectin, collagen-fibronectin heteropolymers).Phosphorylated by FAM20C in the extracellular medium.Proteolytic processing produces the C-terminal NC1 peptide, anastellin. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Store at -80°C. pH: 8.00Constituent: 0.32% Tris HClProprietary formulation of NaCl, KCl, EDTA, Arginine, DTT and Glycerol. |
|---|
For research use only. Not for clinical use.
