Recombinant Human SGK1 Protein (RMPP-00230733)
Cat. No.: RMPP-00230733
Category: Recombinant Protein
Research Area: Immunology
INQUIRY
20 μg
50 μg
Product Features
| Source | E.coli |
|---|---|
| Purity | > 95% SDS-PAGE. |
| Nature | Recombinant |
| Endotoxin Level | ≤ 1.000 Eu/µg |
| Animal Free | No |
| Form | Lyophilized |
| Applications | SDS-PAGE; Functional Studies |
| Key Features | Expression system: E.coli; Purity: > 95% SDS-PAGE; Endotoxin level: ≤ 1.000 Eu/µg; Active: Yes; Suitable for: SDS-PAGE, Functional Studies |
Protein Information
| UniProt ID | P13236 |
|---|---|
| Molecular Weight | 8 kDa |
| Sequence | APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRGKQV CADPSESWVQEYVYDLELN |
| Sequence Similarities | Belongs to the intercrine beta (chemokine CC) family. |
| Protein Length | Full length protein |
| Cellular Localization | Secreted. |
| Function | Monokine with inflammatory and chemokinetic properties. Binds to CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant MIP-1-beta induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). The processed form MIP-1-beta(3-69) retains the abilities to induce down-modulation of surface expression of the chemokine receptor CCR5 and to inhibit the CCR5-mediated entry of HIV-1 in T-cells. MIP-1-beta(3-69) is also a ligand for CCR1 and CCR2 isoform B. |
| Post-translational Modifications | N-terminal processed form MIP-1-beta(3-69) is produced by proteolytic cleavage after secretion from peripheral blood lymphocytes. |
Storage & Shipping
| Shipping and Storage | Shipped at room temperature. Store at -20°C. Constituent: 0.1% Trifluoroacetic acid0.2 micron filtered This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.