Banner

Recombinant Human SGK1 Protein (RMPP-00230733)

Cat. No.: RMPP-00230733

Category: Recombinant Protein

Research Area: Immunology

INQUIRY 20 μg 50 μg

Product Features

Source E.coli
Purity > 95% SDS-PAGE.
Nature Recombinant
Endotoxin Level ≤ 1.000 Eu/µg
Animal Free No
Form Lyophilized
Applications SDS-PAGE; Functional Studies
Key Features Expression system: E.coli; Purity: > 95% SDS-PAGE; Endotoxin level: ≤ 1.000 Eu/µg; Active: Yes; Suitable for: SDS-PAGE, Functional Studies

Protein Information

UniProt ID P13236
Molecular Weight 8 kDa
Sequence APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRGKQV CADPSESWVQEYVYDLELN
Sequence Similarities Belongs to the intercrine beta (chemokine CC) family.
Protein Length Full length protein
Cellular Localization Secreted.
Function Monokine with inflammatory and chemokinetic properties. Binds to CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant MIP-1-beta induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). The processed form MIP-1-beta(3-69) retains the abilities to induce down-modulation of surface expression of the chemokine receptor CCR5 and to inhibit the CCR5-mediated entry of HIV-1 in T-cells. MIP-1-beta(3-69) is also a ligand for CCR1 and CCR2 isoform B.
Post-translational Modifications N-terminal processed form MIP-1-beta(3-69) is produced by proteolytic cleavage after secretion from peripheral blood lymphocytes.

Storage & Shipping

Shipping and Storage Shipped at room temperature. Store at -20°C.
Constituent: 0.1% Trifluoroacetic acid0.2 micron filtered
This product is an active protein and may elicit a biological response in vivo, handle with caution.

For research use only. Not for clinical use.