Recombinant Human soluble IL2 Receptor beta Protein (Fc Chimera) (RMPP-00230049)
Cat. No.: RMPP-00230049
Category: Recombinant Protein
Research Area: Immunology
INQUIRY
50 μg
Customer Size
Product Features
| Source | HEK 293 cells |
|---|---|
| Purity | > 95% SDS-PAGE. >90% as determined by SEC-HPLC. Protein A purified. |
| Nature | Recombinant |
| Endotoxin Level | < 1.000 Eu/µg |
| Animal Free | No |
| Tags | Fc tag C-Terminus |
| Form | Lyophilized |
| Applications | ELISA; Functional Studies; SDS-PAGE |
| Key Features | Expression system: HEK 293 cells; Purity: > 95% SDS-PAGE; Endotoxin level: < 1.000 Eu/µg; Active: Yes; Tags: Fc tag C-Terminus; Suitable for: ELISA, Functional Studies, SDS-PAGE |
Protein Information
| UniProt ID | P25942 |
|---|---|
| Molecular Weight | 45 kDa including tags |
| Sequence | EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDT WNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCV LHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETK DLVVQQAGTNKTDVVCGPQDRLR |
| Sequence Similarities | Contains 4 TNFR-Cys repeats. |
| Protein Length | Protein fragment |
| Cellular Localization | Secreted and Cell membrane. |
| Tissue Specificity | B-cells and in primary carcinomas. |
| Function | Receptor for TNFSF5/CD40LG. |
| Involvement in Disease | Defects in CD40 are the cause of hyper-IgM immunodeficiency syndrome type 3 (HIGM3); also known as hyper-IgM syndrome 3. HIGM3 is an autosomal recessive disorder which includes an inability of B cells to undergo isotype switching, one of the final differentiation steps in the humoral immune system, an inability to mount an antibody-specific immune response, and a lack of germinal center formation. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Store at -20°C or -80°C. pH: 7.4Constituents: 5% Trehalose, 0.75% Glycine, 0.61% Tris, L-Arginine, Sodium chlorideLyophilized from 0.22 µm filtered solution. 5-10% trehalose is commonly used for freeze drying, and after reconstitution, the trehalose is mostly about 3-5% This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.
