Recombinant Human SOX10 Protein (RMPP-00230434)
Cat. No.: RMPP-00230434
Category: Growth Factors & Cytokines
Research Area: Cardiovascular
INQUIRY
10 μg
Customer Size
Product Features
| Source | E.coli |
|---|---|
| Purity | > 97% SDS-PAGE. Purity: >97% by SDS-PAGE and HPLC analyses. |
| Nature | Recombinant |
| Endotoxin Level | < 1.000 Eu/µg |
| Animal Free | No |
| Form | Lyophilized |
| Applications | Functional Studies; SDS-PAGE; HPLC |
| Key Features | Expression system: E.coli; Purity: > 97% SDS-PAGE; Endotoxin level: < 1.000 Eu/µg; Active: Yes; Suitable for: Functional Studies, SDS-PAGE, HPLC |
Protein Information
| UniProt ID | P49771 |
|---|---|
| Molecular Weight | 18 kDa |
| Sequence | TQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVPSNLQDEELCGALWRL VLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQHPPSCLRFVQTN ISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPRSPGALEA TALTAPQRP |
| Protein Length | Protein fragment |
| Cellular Localization | Secreted and Cell membrane. |
| Function | Stimulates the proliferation of early hematopoietic cells by activating FLT3. Synergizes well with a number of other colony stimulating factors and interleukins. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. pH: 7.40Constituent: 100% PBS This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.
