Banner

Recombinant Human TGF beta Receptor I (mutated T204D) Protein (Active)

Recombinant Human TGF beta Receptor I (mutated T204D) Protein (Active) (RMPP-00230712)

Cat. No.: RMPP-00230712

Category: Recombinant Protein

Research Area: Immunology

INQUIRY 10 μg 5 μg

Product Features

Source E.coli
Purity > 95% SDS-PAGE.
Nature Recombinant
Endotoxin Level ≤ 1.000 Eu/µg
Animal Free Yes
Form Lyophilized
Applications SDS-PAGE; Functional Studies
Key Features Expression system: E.coli; Purity: > 95% SDS-PAGE; Endotoxin level: ≤ 1.000 Eu/µg; Active: Yes; Suitable for: SDS-PAGE, Functional Studies

Protein Information

UniProt ID P01583
Molecular Weight 18 kDa
Sequence MSAPYTYQSDLRYKLMKLVRQKFVMNDSLNQTIYQDVDKHYLSTTWLNDL QQEVKFDMYAYSSGGDDSKYPVTLKISDSQLFVSAQGEDQPVLLKELPET PKLITGSETDLIFFWKSINSKNYFTSAAYPELFIATKEQSRVHLARGLPS MTDFQIS
Sequence Similarities Belongs to the IL-1 family.
Protein Length Full length protein
Cellular Localization Secreted. The lack of a specific hydrophobic segment in the precursor sequence suggests that IL-1 is released by damaged cells or is secreted by a mechanism differing from that used for other secretory proteins.
Domain The similarity among the IL-1 precursors suggests that the amino ends of these proteins serve some as yet undefined function.
Function Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells.

Storage & Shipping

Shipping and Storage Shipped at room temperature. Store at -20°C.
Constituent: 0.16% Sodium phosphate0.2 micron filtered
This product is an active protein and may elicit a biological response in vivo, handle with caution.

For research use only. Not for clinical use.