Recombinant Human VCAM1 Protein (His tag) (RMPP-00230914)
Cat. No.: RMPP-00230914
Category: Recombinant Protein
Research Area: Stem Cells
INQUIRY
50 μg
Customer Size
Product Features
| Source | Wheat germ |
|---|---|
| Nature | Recombinant |
| Animal Free | No |
| Form | Liquid |
| Applications | SDS-PAGE; WB; ELISA |
| Key Features | Expression system: Wheat germ; Suitable for: SDS-PAGE, WB, ELISA |
Protein Information
| UniProt ID | P56706 |
|---|---|
| Molecular Weight | 38 kDa including tags |
| Sequence | VRASRLRQPTFLRIKQLRSYQKPMETDLVYIEKSPNYCEEDAATGSVGTQ GRLCNRTSPGADGCDTMCCGRGYNTHQYTKVWQCNCKFHWCCFVKCNTCS ERTEVFTCK |
| Sequence Similarities | Belongs to the Wnt family. |
| Protein Length | Protein fragment |
| Cellular Localization | Secreted > extracellular space > extracellular matrix. |
| Tissue Specificity | Moderately expressed in fetal brain, weakly expressed in fetal lung and kidney, and faintly expressed in adult brain, lung and prostate. |
| Function | Ligand for members of the frizzled family of seven transmembrane receptors. Probable developmental protein. May be a signaling molecule which affects the development of discrete regions of tissues. Is likely to signal over only few cell diameters. |
Storage & Shipping
| Shipping and Storage | Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles. pH: 8.00Constituents: 0.31% Glutathione, 0.79% Tris HCl |
|---|
For research use only. Not for clinical use.
