Recombinant Human VEGF Receptor 2 Protein (Active) (RMPP-00230423)
Cat. No.: RMPP-00230423
Category: Recombinant Protein
Research Area: Stem Cells
INQUIRY
5 μg
Customer Size
Product Features
| Source | CHO cells |
|---|---|
| Purity | > 95% SDS-PAGE. >95% by HPLC. |
| Nature | Recombinant |
| Endotoxin Level | < 1.000 Eu/µg |
| Animal Free | No |
| Form | Lyophilized |
| Applications | Functional Studies; SDS-PAGE; HPLC |
| Key Features | Expression system: CHO cells; Purity: > 95% SDS-PAGE; Endotoxin level: < 1.000 Eu/µg; Active: Yes; Suitable for: Functional Studies, SDS-PAGE, HPLC |
Protein Information
| UniProt ID | Q6FHJ7 |
|---|---|
| Molecular Weight | 38 kDa |
| Sequence | VRGAPCEAVRIPMCRHMPWNITRMPNHLHHSTQENAILAIEQYEELVDVN CSAVLRFFLCAMYAPICTLEFLHDPIKPCKSVCQRARDDCEPLMKMYNHS WPESLACDELPVYDRGVCISPEAIVTDLPEDVKWIDITPDMMVQERPLDV DCKRLSPDRCKCKKVKPTLATYLSKNYSYVIHAKIKAVQRSGCNEVTTVV DVKEIFKSSSPIPRTQVPLITNSSCQCPHILPHQDVLIMCYEWRSRMMLL ENCLVEKWRDQLSKRSIQWEERLQEQRRTVQDKKKTAGRTSRSNPPKPKG KPPAPKPASPKKNIKTRSAQKRTNPKRV |
| Sequence Similarities | Belongs to the secreted frizzled-related protein (sFRP) family. Contains 1 FZ (frizzled) domain. Contains 1 NTR domain. |
| Protein Length | Full length protein |
| Cellular Localization | Secreted. Cytoplasmic in ovarian tumor cells. |
| Tissue Specificity | Expressed in mesenchymal cells. Highly expressed in the stroma of proliferative endometrium. Expressed in cardiomyocytes. Shows moderate to strong expression in ovarian tumors with expression increasing as the tumor stage increases. In ovarian tumors, expression levels are inversely correlated with expression of CTNNB1 (at protein level). |
| Domain | The FZ domain is involved in binding with Wnt ligands. |
| Function | Soluble frizzled-related proteins (sFRPS) function as modulators of Wnt signaling through direct interaction with Wnts. They have a role in regulating cell growth and differentiation in specific cell types. SFRP4 may act as a regulator of adult uterine morphology and function. Increases apoptosis during ovulation possibly through modulation of FZ1/FZ4/WNT4 signaling (By similarity). Has phosphaturic effects by specifically inhibiting sodium-dependent phosphate uptake. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. Sterile filtered through a 0.2 micron filter. Lyophilized from 10mM Sodium Phosphate. This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.
