Recombinant Human Wnt6 Protein (RMPP-00230685)
Cat. No.: RMPP-00230685
Category: Recombinant Protein
Research Area: Cardiovascular
INQUIRY
2 μg
Customer Size
Product Features
| Source | Insect cells |
|---|---|
| Purity | > 95% SDS-PAGE. |
| Nature | Recombinant |
| Animal Free | No |
| Form | Lyophilized |
| Applications | SDS-PAGE; Functional Studies |
| Key Features | Expression system: Insect cells; Purity: > 95% SDS-PAGE; Active: Yes; Suitable for: SDS-PAGE, Functional Studies |
Protein Information
| UniProt ID | P40225 |
|---|---|
| Molecular Weight | 66 kDa |
| Sequence | SPVAPACDPRLLNKLLRDSHLLHSRLSQCPDVDPLSIPVLLPAVDFSLGE WKTQTEQSKAQDILGAVSLLLEGVMAARGQLEPSCLSSLLGQLSGQVRLL LGALQGLLGTQLPLQGRTTAHKDPNALFLSLQQLLRGKVRFLLLVEGPTL CVRRTLPTTAVPSSTSQLLTLNKFPNRTSGLLETNFSVTARTAGPGLLSR LQGFRVKITPGQLNQTSRSPVQISGYLNRTHGPVNGTHGLFAGTSLQTLE ASDISPGAFNKGSLAFNLQGGLPPSPSLAPDGHTPFPPSPALPTTHGSPP QLHPLFPDPSTTMPNSTAPHPVTMYPHPRNLSQET |
| Sequence Similarities | Belongs to the EPO/TPO family. |
| Protein Length | Full length protein |
| Cellular Localization | Secreted. |
| Domain | Two-domain structure with an erythropoietin-like N-terminal and a Ser/Pro/Thr-rich C-terminal. |
| Function | Lineage-specific cytokine affecting the proliferation and maturation of megakaryocytes from their committed progenitor cells. It acts at a late stage of megakaryocyte development. It may be the major physiological regulator of circulating platelets. |
| Involvement in Disease | Defects in THPO are a cause of essential thrombocythemia (ET). ET is inherited as an autosomal dominant trait which is characterized by elevated platelet levels due to sustained proliferation of megakaryocytes, and frequently lead to thrombotic and haemorrhagic complications. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Store at -80°C. pH: 7.4Constituent: 100% PBS This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.
