Recombinant Mouse CD80 Protein (Active) (RMPP-00230286)
Cat. No.: RMPP-00230286
Category: Growth Factors & Cytokines
Research Area: Immunology
INQUIRY
100 μg
Customer Size
Product Features
| Source | E.coli |
|---|---|
| Purity | > 95% SDS-PAGE. The purity ofthis product is determined by Reducing and Non-reducing SDS-PAGE. |
| Nature | Recombinant |
| Endotoxin Level | ≤ 1.000 Eu/µg |
| Animal Free | Yes |
| Form | Lyophilized |
| Applications | Functional Studies; SDS-PAGE |
| Key Features | Expression system: E.coli; Purity: > 95% SDS-PAGE; Endotoxin level: ≤ 1.000 Eu/µg; Active: Yes; Suitable for: Functional Studies, SDS-PAGE |
Protein Information
| UniProt ID | P09919 |
|---|---|
| Molecular Weight | 19 kDa |
| Sequence | MTPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVL LGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPEL GPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAG GVLVASHLQSFLEVSYRVLRHLAQP |
| Sequence Similarities | Belongs to the IL-6 superfamily. |
| Protein Length | Protein fragment |
| Cellular Localization | Secreted. |
| Function | Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. This CSF induces granulocytes. |
| Post-translational Modifications | O-glycan consists of Gal-GalNAc disaccharide which can be modified with up to two sialic acid residues (done in recombinantly expressed G-CSF from CHO cells). |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Store at -20°C. Avoid freeze / thaw cycle. Constituent: 0.1% Trifluoroacetic acidLyophilised from a sterile (0.2 micron) filtered solution. This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.