Banner

Recombinant Mouse CSF-1-R Protein (Fc Chimera Active)

Recombinant Mouse CSF-1-R Protein (Fc Chimera Active) (RMPP-00230675)

Cat. No.: RMPP-00230675

Category: Actin Binding Proteins

Research Area: Signal Transduction

INQUIRY 100 μg Customer Size

Product Features

Source Baculovirus infected Sf9 cells
Purity > 95% Densitometry. Affinity purified.
Nature Recombinant
Animal Free No
Tags GST tag N-Terminus
Modifications mutated Q207E
Form Liquid
Applications SDS-PAGE; Functional Studies
Key Features Expression system: Baculovirus infected Sf9 cells; Purity: > 95% Densitometry; Active: Yes; Tags: GST tag N-Terminus; Suitable for: SDS-PAGE, Functional Studies

Protein Information

UniProt ID Q04771
Molecular Weight 67 kDa including tags
Sequence RKFKRRNQERLNPRDVEYGTIEGLITTNVGDSTLADLLDHSCTSGSGSGL PFLVQRTVARQITLLECVGKGRYGEVWRGSWQGENVAVKIFSSRDEKSWF RETELYNTVMLRHENILGFIASDMTSRHSSTQLWLITHYHEMGSLYDYLQ LTTLDTVSCLRIVLSIASGLAHLHIEIFGTQGKPAIAHRDLKSKNILVKK NGQCCIADLGLAVMHSQSTNQLDVGNNPRVGTKRYMAPEV
LDETIQVD CFDSYKRVDIWAFGLVLWEVARRMVSNGIVEDYKPPFYDVVPNDPSFEDM RKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTALRIKKT LTKIDNSLDKLKTDC
Sequence Similarities Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family. TGFB receptor subfamily. Contains 1 GS domain. Contains 1 protein kinase domain.
Protein Length Protein fragment
Cellular Localization Membrane.
Tissue Specificity Expressed in normal parenchymal cells, endothelial cells, fibroblasts and tumor-derived epithelial cells.
Function On ligand binding, forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. Receptor for activin. May be involved for left-right pattern formation during embryogenesis.
Involvement in Disease Defects in ACVR1 are a cause of fibrodysplasia ossificans progressiva (FOP). FOP is a rare autosomal dominant disorder of skeletal malformations and progressive extraskeletal ossification. Heterotopic ossification in FOP begins in childhood and can be induced by trauma or may occur without warning. Bone formation is episodic and progressive, leading to extra-articular ankylosis of all major joints of the axial and appendicular skeleton, rendering movement impossible.

Storage & Shipping

Shipping and Storage Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.
pH: 7.50Constituents: 25% Glycerol (glycerin, glycerine), 0.002% PMSF, 0.004% DTT, 0.003% EDTA, 0.31% Glutathione, 0.87% Sodium chloride, 0.79% Tris HCl
This product is an active protein and may elicit a biological response in vivo, handle with caution.

For research use only. Not for clinical use.