Recombinant Mouse CSF-1-R Protein (Fc Chimera Active) (RMPP-00230675)
Cat. No.: RMPP-00230675
Category: Actin Binding Proteins
Research Area: Signal Transduction
INQUIRY
100 μg
Customer Size
Product Features
| Source | Baculovirus infected Sf9 cells |
|---|---|
| Purity | > 95% Densitometry. Affinity purified. |
| Nature | Recombinant |
| Animal Free | No |
| Tags | GST tag N-Terminus |
| Modifications | mutated Q207E |
| Form | Liquid |
| Applications | SDS-PAGE; Functional Studies |
| Key Features | Expression system: Baculovirus infected Sf9 cells; Purity: > 95% Densitometry; Active: Yes; Tags: GST tag N-Terminus; Suitable for: SDS-PAGE, Functional Studies |
Protein Information
| UniProt ID | Q04771 |
|---|---|
| Molecular Weight | 67 kDa including tags |
| Sequence | RKFKRRNQERLNPRDVEYGTIEGLITTNVGDSTLADLLDHSCTSGSGSGL PFLVQRTVARQITLLECVGKGRYGEVWRGSWQGENVAVKIFSSRDEKSWF RETELYNTVMLRHENILGFIASDMTSRHSSTQLWLITHYHEMGSLYDYLQ LTTLDTVSCLRIVLSIASGLAHLHIEIFGTQGKPAIAHRDLKSKNILVKK NGQCCIADLGLAVMHSQSTNQLDVGNNPRVGTKRYMAPEV LDETIQVD CFDSYKRVDIWAFGLVLWEVARRMVSNGIVEDYKPPFYDVVPNDPSFEDM RKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTALRIKKT LTKIDNSLDKLKTDC |
| Sequence Similarities | Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family. TGFB receptor subfamily. Contains 1 GS domain. Contains 1 protein kinase domain. |
| Protein Length | Protein fragment |
| Cellular Localization | Membrane. |
| Tissue Specificity | Expressed in normal parenchymal cells, endothelial cells, fibroblasts and tumor-derived epithelial cells. |
| Function | On ligand binding, forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. Receptor for activin. May be involved for left-right pattern formation during embryogenesis. |
| Involvement in Disease | Defects in ACVR1 are a cause of fibrodysplasia ossificans progressiva (FOP). FOP is a rare autosomal dominant disorder of skeletal malformations and progressive extraskeletal ossification. Heterotopic ossification in FOP begins in childhood and can be induced by trauma or may occur without warning. Bone formation is episodic and progressive, leading to extra-articular ankylosis of all major joints of the axial and appendicular skeleton, rendering movement impossible. |
Storage & Shipping
| Shipping and Storage | Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle. pH: 7.50Constituents: 25% Glycerol (glycerin, glycerine), 0.002% PMSF, 0.004% DTT, 0.003% EDTA, 0.31% Glutathione, 0.87% Sodium chloride, 0.79% Tris HCl This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.
