Recombinant Mouse GDF 5 Protein (RMPP-00230973)
Cat. No.: RMPP-00230973
Category: Recombinant Protein
Research Area: Cell Biology
INQUIRY
50 μg
Customer Size
Product Features
| Source | Wheat germ |
|---|---|
| Nature | Recombinant |
| Animal Free | No |
| Form | Liquid |
| Applications | WB; ELISA; SDS-PAGE |
| Key Features | Expression system: Wheat germ; Suitable for: WB, ELISA, SDS-PAGE |
Protein Information
| UniProt ID | P35226 |
|---|---|
| Molecular Weight | 62 kDa including tags |
| Sequence | MHRTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETS KYCPICDVQVHKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDFYAA HPSADAANGSNEDRGEVADEDKRIITDDEIISLSIEFFDQNRLDRKVNKD KEKSKEEVNDKRYLRCPAAMTVMHLRKFLRSKMDIPNTFQIDVMYEEEPL KDYYTLMDIAYIYTWRRNGPLPLKYRVRPTCKRMKISHQRDGLTNAGELE SDSGSDKANSPAGGIPSTSSCLPSPSTPVQSPHPQFPHISSTMNGTSNSP SGNHQSSFANRPRKASVNGSSATSSG |
| Sequence Similarities | Contains 1 RING-type zinc finger. |
| Protein Length | Full length protein |
| Cellular Localization | Nucleus. Cytoplasm. |
| Function | Component of the Polycomb group (PcG) multiprotein PRC1 complex, a complex required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones; it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility. In the PRC1 complex, it is required to stimulate the E3 ubiquitin-protein ligase activity of RNF2/RING2. |
| Post-translational Modifications | Monoubiquitinated (By similarity). May be polyubiquitinated; which does not lead to proteasomal degradation. |
Storage & Shipping
| Shipping and Storage | Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles. pH: 8.00Constituents: 0.3% Glutathione, 0.79% Tris HCl |
|---|
For research use only. Not for clinical use.
