Banner

Recombinant Mouse GFAP Protein (His tag)

Recombinant Mouse GFAP Protein (His tag) (RMPP-00230283)

Cat. No.: RMPP-00230283

Category: Recombinant Protein

Research Area: Neuroscience

INQUIRY 100 μg Customer Size

Product Features

Source Baculovirus infected Sf9 cells
Purity ≥ 90% SDS-PAGE. Affinity purified.
Nature Recombinant
Animal Free No
Tags GST tag N-Terminus
Form Liquid
Applications Functional Studies; SDS-PAGE
Key Features Expression system: Baculovirus infected Sf9 cells; Purity: ≥ 90% SDS-PAGE; Active: Yes; Tags: GST tag N-Terminus; Suitable for: Functional Studies, SDS-PAGE

Protein Information

UniProt ID P49841
Sequence MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDR PQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQI MRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAK QTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCD FGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAEL LLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHP WTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKL PNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDA NTGDRGQTNNAASASASNST
Sequence Similarities Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. GSK-3 subfamily. Contains 1 protein kinase domain.
Protein Length Full length protein
Cellular Localization Cytoplasm. Nucleus. Cell membrane. The phosphorylated form shows localization to cytoplasm and cell membrane. The MEMO1-RHOA-DIAPH1 signaling pathway controls localization of the phosophorylated form to the cell membrane.
Tissue Specificity Expressed in testis, thymus, prostate and ovary and weakly expressed in lung, brain and kidney.
Function Participates in the Wnt signaling pathway. Implicated in the hormonal control of several regulatory proteins including glycogen synthase, MYB and the transcription factor JUN. Phosphorylates JUN at sites proximal to its DNA-binding domain, thereby reducing its affinity for DNA. Phosphorylates MUC1 in breast cancer cells, and decreases the interaction of MUC1 with CTNNB1/beta-catenin. Phosphorylates CTNNB1/beta-catenin. Phosphorylates SNAI1. Plays an important role in ERBB2-dependent stabilization of microtubules at the cell cortex. Prevents the phosphorylation of APC and CLASP2, allowing its association with the cell membrane. In turn, membrane-bound APC allows the localization of MACF1 to the cell membrane, which is required for microtubule capture and stabilization. Phosphorylates MACF1 and this phosphorylation inhibits the binding of MACF1 to microtubules which is critical for its role in bulge stem cell migration and skin wound repair.
Post-translational Modifications Phosphorylated by AKT1 and ILK1. Activated by phosphorylation at Tyr-216.

Storage & Shipping

Shipping and Storage Shipped on Dry Ice. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 8.00Constituents: 0.63% Tris HCl, 0.64% Sodium chloride, 0.02% Potassium chloride, 0.05% (R*,R*)-1,4-Dimercaptobutan-2,3-diol, 20% Glycerol (glycerin, glycerine), 0.49% Glutathione
This product is an active protein and may elicit a biological response in vivo, handle with caution.

For research use only. Not for clinical use.